JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB92846

Recombinant rat VEGFA protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant rat VEGFA protein is a Rat Fragment protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Vegf, Vegfa, Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF

3 Images
Functional Studies - Recombinant rat VEGFA protein (AB92846)
  • FuncS

Unknown

Functional Studies - Recombinant rat VEGFA protein (AB92846)

Functional analysis of ab92846

Functional Studies - Recombinant rat VEGFA protein (AB92846)
  • FuncS

Unknown

Functional Studies - Recombinant rat VEGFA protein (AB92846)

ab92846 used in Functional Studies.

SDS-PAGE - Recombinant rat VEGFA protein (AB92846)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant rat VEGFA protein (AB92846)

SDS PAGE analysis of ab92846 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Biological Activity: As determined by the dose-dependent induced proliferation of Human umbilical vein endothelial cells (HUVECs) when compared to a standard. The expected ED50 is 4.0-8.0 ng/ml.

Accession

P16612

Animal free

No

Carrier free

No

Species

Rat

Reconstitution

Reconstitute at 0.1 mg/mL in water

Storage buffer

Constituents: 0.165% Sodium phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Endotoxin Level:Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.

Sequence info

[{"sequence":"MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P16612","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Vascular endothelial growth factor A (VEGFA) also known as VEGF or vascular permeability factor (VPF) is a protein that plays a central role in angiogenesis as well as in the growth of blood vessels. The molecular weight of VEGFA varies depending on the isoform typically ranging from 34 to 42 kDa. VEGFA is expressed in many tissues including fibroblasts macrophages endothelial cells and platelets. Its expression levels can increase in response to stimuli like hypoxia or inflammatory cytokines. VEGFA is an important target in research for therapies related to vascular diseases and cancer.
Biological function summary

VEGFA functions by promoting the proliferation and migration of vascular endothelial cells. It operates both as a homodimer and as part of complex signaling cascades interacting with VEGF receptors on cell surfaces to trigger downstream signals for angiogenesis. This includes endothelial cell growth migration and the new blood vessel formation process. VEGFA's activity is important for physiological processes such as wound healing and embryonic development and it also contributes to pathological conditions through its unregulated expression in diseases.

Pathways

Many processes involve VEGFA including the PI3K/AKT pathway and the MAPK/ERK pathway. These pathways regulate cell survival growth and differentiation. Other proteins like PLGF (placenta growth factor) and VEGFB often accompany VEGFA in these pathways aiding in distinct but overlapping roles. These interactions are transmitted through binding to VEGF receptors such as VEGFR-1 and VEGFR-2 subsequently activating various signaling cascades necessary for cellular and tissue homeostasis.

VEGFA relates to cancer and age-related macular degeneration among others. In cancer overexpression of VEGFA can lead to excessive angiogenesis supplying blood to tumors and facilitating tumor growth. In age-related macular degeneration upregulation of VEGFA contributes to the progression of the disease by promoting the formation of abnormal blood vessels under the retina. Anti-VEGFA therapies such as anti-VEGF antibodies (e.g. bevacizumab) can target these overexpressed pathways. VEGFA interacts with other proteins like HIF-1α which regulates its expression under hypoxia a common condition in tumors.

Specifications

Form

Lyophilized

Additional notes

Purity is approximately 97% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE.

General info

Function

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (By similarity).

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Product protocols

Target data

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (By similarity).
See full target information Vegfa

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com