JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB52146

Recombinant rat VEGFC protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant rat VEGFC protein is a Rat Full Length protein, in the 101 to 221 aa range, expressed in Insect cells, with >90%, suitable for FuncS, SDS-PAGE.

View Alternative Names

Vascular endothelial growth factor C, VEGF-C, Flt4 ligand, Vascular endothelial growth factor-related protein, Flt4-L, VRP, Vegfc

3 Images
Functional Studies - Recombinant rat VEGFC protein (AB52146)
  • FuncS

Unknown

Functional Studies - Recombinant rat VEGFC protein (AB52146)

In vivo : The lymphangiogenic response to recombinant rat VEGF-CC152S loaded in our biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats. Briefly, after ischemia-reperfusion injury to induce myocardial infarction, VEGF-CC152S at the dose of 1.5 or 5 μg per heart was injected intra-myocardially. Lymphatic responses in the myocardium were analyzed by IHC at 3 weeks post-MI using LYVE1 antibody (RT, #103-PA50). Results are expressed as lymphatic vessel to cardiomyocyte ratio (mean ± sem).

Functional Studies - Recombinant rat VEGFC protein (AB52146)
  • FuncS

Unknown

Functional Studies - Recombinant rat VEGFC protein (AB52146)

In vitro : The proliferative response to recombinant rat VEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells. Briefly, cells were plated in 12-well plates and incubated in DMEM medium supplemented with 1% fetal calf serum for cell cycle arrest 24h prior to stimulation of cell proliferation with recombinant VEGF-CC152S at the concentrations of 50 and 100 ng/mL. After 48h in culture, the cell proliferative response was assayed (WST-1 colorimetric assay), and the results expressed as % of control non-stimulated cells (mean ± sem).

SDS-PAGE - Recombinant rat VEGFC protein (AB52146)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant rat VEGFC protein (AB52146)

SDS-PAGE analysis of recombinant rat VEGF-C152 mutant. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.

Key facts

Purity

>90% SDS-PAGE

Expression system

Insect cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

This product is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT -4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR.

Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells (PAE/FLT -4 cells). The ED50 for this effect is typically 150-300 ng/ml. Inactive in the vascular permeability assay.

Accession

O35757

Animal free

No

Carrier free

No

Species

Rat

Reconstitution

reconstitute with PBS at 50µg/mL

Storage buffer

Constituents: BSA, PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>As a result of glycosylation VEGFC migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.</p>" } } }

Product details

Source: Insect cells.

Sequence info

[{"sequence":"DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":221,"aminoAcidStart":101,"nature":"Recombinant","expressionSystem":"Insect cells","accessionNumber":"O35757","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VEGFC also known as Vascular Endothelial Growth Factor C is a member of the VEGF family involved in angiogenesis and lymphangiogenesis. It has a molecular mass of approximately 35 kDa. VEGFC is expressed in various tissues with high levels in the heart lung and muscle. It acts primarily through its interaction with the VEGFR-3 receptor stimulating the formation of blood and lymphatic vessels. This protein plays an important role in the development and maintenance of the circulatory and lymphatic systems.
Biological function summary

VEGFC contributes to the regulation of vascular and lymphatic endothelial cell functions. It is not known to be part of a larger protein complex but exerts its functions through interactions with receptors such as VEGFR-3. By promoting cell proliferation and migration VEGFC assists in the repair and regeneration of tissues. Its role in fluid balance is essential as it helps maintain tissue equilibrium and immune function.

Pathways

VEGFC is integral to the VEGF signaling and lymphatic vessel development pathways. Within these processes VEGFC works alongside other proteins such as VEGFA and VEGFB to modulate vascular permeability and vessel formation. The interaction between VEGFC and the VEGFR-3 receptor specifically mediates lymphatic endothelial cell activation and function linking it to vital physiological processes like inflammation and tissue repair.

VEGFC is associated with cancer and lymphedema. Its role in promoting angiogenesis is critical in tumor growth and metastasis with its overexpression often linked to cancer progression. Furthermore insufficient VEGFC activity contributes to the development of lymphedema due to inadequate lymphatic drainage. In cancer pathology VEGFC works together with VEGFR-3 contributing to the abnormal growth of lymphatic vessels which in turn facilitates cancer cell dissemination.

Specifications

Form

Lyophilized

Additional notes

Purity >90% by SDS-PAGE and visualised by silver stain.Product is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGFC by a Ser residue. Affinity purified.

General info

Function

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-223 and Ser-224 producing a heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions (By similarity).

Product protocols

Target data

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.
See full target information Vegfc

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com