JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB238376

Recombinant Rotavirus X VP4 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Rotavirus X VP4 protein (His tag) is a Human rotavirus B219 Fragment protein, in the 1 to 249 aa range, expressed in Yeast, with >85%, suitable for SDS-PAGE.

View Alternative Names

Outer capsid protein VP4, Hemagglutinin

1 Images
SDS-PAGE - Recombinant Rotavirus X VP4 protein (His tag) (AB238376)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rotavirus X VP4 protein (His tag) (AB238376)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab238376.

Key facts

Purity

>85% SDS-PAGE

Expression system

Yeast

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

A9Q1L0

Animal free

No

Carrier free

No

Species

Human rotavirus B219

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR","proteinLength":"Fragment","predictedMolecularWeight":"30.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":249,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Yeast","accessionNumber":"A9Q1L0","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Rotavirus VP4 also known as rotaviral attachment protein is a structural protein of the rotavirus. It plays an important role in the virus's ability to infect host cells. This protein has an approximate molecular mass of 88 kDa. VP4 expresses on the outer surface of the rotavirus where it functions as a spike protein mediating attachment to cells and facilitating viral entry through membrane penetration. Its structural characteristics allow it to undergo conformational changes necessary for these processes.
Biological function summary

The infectivity of rotaviruses depends significantly on the activity of VP4. VP4 forms part of a complex with the viral capsid proteins including VP6 and VP7 contributing to the stability and infection potential of the virus. The protein is cleaved by trypsin into two subunits VP5* and VP8* which increases the virus's ability to bind and penetrate host cells. This cleavage is an important step in the viral life cycle enhancing the infectivity of the virus.

Pathways

The mechanism of VP4 is tightly linked to cellular pathways involving viral entry and replication. During infection VP4's interaction with cell surface molecules facilitates the entry of the virus directly impacting viral proliferation pathways. It shows significant interaction with cellular receptors like integrins which play a role in cell adhesion processes and signal transduction. These interactions can influence downstream effects on host cell functions and viral replication efficiency.

VP4 is a central factor in rotavirus-associated gastroenteritis a leading cause of severe diarrhea in infants and young children. The protein's ability to mediate viral entry into gastrointestinal epithelial cells makes it a target for vaccine development aimed at preventing rotavirus infections. The protein also interacts closely with NSP4 another rotavirus protein that acts as an enterotoxin exacerbating the symptoms of infection. Understanding the role of VP4 can provide insights into designing therapies to mitigate the impact of rotavirus-induced diseases.

Specifications

Form

Liquid

General info

Function

Outer capsid protein VP4. Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. It is subsequently lost, together with VP7, following virus entry into the host cell. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.. Outer capsid protein VP5*. Forms the spike 'foot' and 'body' and acts as a membrane permeabilization protein that mediates release of viral particles from endosomal compartments into the cytoplasm. During entry, the part of VP5* that protrudes from the virus folds back on itself and reorganizes from a local dimer to a trimer. This reorganization may be linked to membrane penetration.. Outer capsid protein VP8*. Forms the head of the spikes and mediates the recognition of specific host cell surface glycans. It is the viral hemagglutinin and an important target of neutralizing antibodies.

Sequence similarities

Belongs to the rotavirus VP4 family.

Post-translational modifications

Outer capsid protein VP4. Proteolytic cleavage by trypsin results in activation of VP4 functions and greatly increases infectivity. The penetration into the host cell is dependent on trypsin treatment of VP4. It produces two peptides, VP5* and VP8* that remain associated with the virion. Cleavage of VP4 by trypsin probably occurs in vivo in the lumen of the intestine prior to infection of enterocytes. Trypsin seems to be incorporated into the three-layered viral particles but remains inactive as long as the viral outer capsid is intact and would only be activated upon the solubilization of the latter.

Product protocols

Target data

Outer capsid protein VP4. Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. It is subsequently lost, together with VP7, following virus entry into the host cell. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.. Outer capsid protein VP5*. Forms the spike 'foot' and 'body' and acts as a membrane permeabilization protein that mediates release of viral particles from endosomal compartments into the cytoplasm. During entry, the part of VP5* that protrudes from the virus folds back on itself and reorganizes from a local dimer to a trimer. This reorganization may be linked to membrane penetration.. Outer capsid protein VP8*. Forms the head of the spikes and mediates the recognition of specific host cell surface glycans. It is the viral hemagglutinin and an important target of neutralizing antibodies.
See full target information VP4_ROTB2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com