JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB256430

Recombinant Rubella Virus capsid nucleoprotein protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Rubella Virus capsid nucleoprotein protein (His tag) is a Rubella virus strain Therien Full Length protein, in the 1 to 300 aa range, expressed in HEK 293 cells, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Structural polyprotein, p110, Coat protein, Structural polyprotein, p110, rubella capsid

3 Images
Functional Studies - Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (AB256430)
  • FuncS

Supplier Data

Functional Studies - Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (AB256430)

Detection of anti-Rubella IgM in human serum.

Plate coated with 100 ng/well of antigens. NP = ab256430

Washed x3 with Tris washing buffer.

Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T + 4% IgG/RF stripper. After standing for 30 minutes the diluted samples were centrifuged at 17,000 x g for 1 minute and the supernatant used for ELISA.

Secondary antibody was anti-Human-IgM-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.

Functional Studies - Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (AB256430)
  • FuncS

Supplier Data

Functional Studies - Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (AB256430)

Detection of anti-Rubella IgG in human serum.

Plate coated with 50 ng/well of antigens. NP = ab256430

Antigens coated in bicarbonate-carbonate buffer pH 9.6 for 1 hour at RT. Blocked with 2% BSA/PBS for 2 hours at RT.

Washed x3 with Tris washing buffer.

Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T.

Secondary antibody was anti-Human-IgG-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.

SDS-PAGE - Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (AB256430)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (AB256430)

SDS-PAGE analysis of ab256430 under reducing conditions.

Key facts

Purity

>95% SDS-PAGE

Expression system

HEK 293 cells

Tags

6x His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

No

Accession

P07566

Animal free

No

Carrier free

No

Species

Rubella virus strain Therien

Storage buffer

pH: 7 - 8 Constituents: 0.5% Sodium lauryl sulfate, 0.32% Tris HCl, 0.29% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":"10 amino acid glycine-serine linker","sequence":"MASTTPITMEDLQKALEAQSRALRAELAAGASQSRRPRPPRQRDSSTSGDDSGRDSGGPRRRRGNRGRGQRRDWSRAPPPPEERQETRSQTPAPKPSRAPPQQPQPPRMQTGRGGSAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPTEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGLDGDSAPLPPHTTERIETRSARHPWRIRFGAPQAFLAGLLLATVAVGTARA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":300,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P07566","tags":[{"tag":"6x His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Rubella Virus capsid is an important structural component of the Rubella virus particle. Sometimes called the capsid protein or capsid proteins it is involved in the assembling and packaging of the viral genome into new virions. The Rubella Virus capsid protein is around 33 kilodaltons in mass. It is expressed within infected host cells where it facilitates the initial steps of viral replication and particle formation. This capsid protein is essential for the structural integrity of the virus ensuring proper encapsulation of the viral RNA.
Biological function summary

The Rubella Virus capsid interacts with various host cell factors to mediate processes like viral assembly and budding. It is part of a capsid protein complex which plays a role in the lifecycle of the virus by protecting the viral nucleic material. This nucleoprotein protein interacts with the host cell’s machinery influencing cell entry and immune evasion. The capsid elicits immune responses in the host which are detectable through assays such as the capsid ELISA often used in anti-rubella serological testing.

Pathways

The Rubella Virus capsid is closely associated with the viral replication pathway and immune signaling pathways. It partners with other viral proteins to regulate replication ensuring successful synthesis of new virus particles. The host immune response against the capsid is significant involving pathways that trigger antibody production. The interaction of capsid proteins with host elements can modify immune responses assisting the virus in evading detection. Notable related proteins include the envelope proteins which work in tandem during the viral lifecycle.

The Rubella Virus capsid is fundamentally linked to rubella particularly congenital rubella syndrome. This capsid protein triggers immune responses that may not fully prevent infection but are important in diagnostic evaluations through tools like anti-rubella ELISA. Rubella infection can impact fetal development during pregnancy leading to severe outcomes. The interaction of the capsid with other viral components like the nucleoprotein protein is significant in the spread and pathology of the virus influencing the course of infectivity and disease manifestation.

Specifications

Form

Liquid

Additional notes

Buffered in 20mM TRIS-HCl pH8.0, 50mM NaCl, 0.5% SDS.Purified from cell lysate.

General info

Function

Capsid protein. Capsid protein interacts with genomic RNA and assembles into icosahedric core particles 65-70 nm in diameter. The resulting nucleocapsid eventually associates with the cytoplasmic domain of E2 at the cell membrane, leading to budding and formation of mature virions from host Golgi membranes. Phosphorylation negatively regulates RNA-binding activity, possibly delaying virion assembly during the viral replication phase. Capsid protein dimerizes and becomes disulfide-linked in the virion. Modulates genomic RNA replication. Modulates subgenomic RNA synthesis by interacting with human C1QBP/SF2P32. Induces both perinuclear clustering of mitochondria and the formation of electron-dense intermitochondrial plaques, both hallmarks of rubella virus infected cells. Induces apoptosis when expressed in transfected cells.. Spike glycoprotein E2. Responsible for viral attachment to target host cell, by binding to the cell receptor. Its transport to the plasma membrane depends on interaction with E1 protein. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement.. Spike glycoprotein E1. Class II viral fusion protein (By similarity). Fusion activity is inactive as long as E1 is bound to E2 in mature virion. After virus attachment to target cell and clathrin-mediated endocytosis, acidification of the endosome would induce dissociation of E1/E2 heterodimer and concomitant trimerization of the E1 subunits (PubMed : 15557740). This E1 homotrimer is fusion active, and promotes release of viral nucleocapsid in cytoplasm after endosome and viral membrane fusion. The cytoplasmic tail of spike glycoprotein E1 modulates virus release. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement (By similarity).

Post-translational modifications

Structural polyprotein: Specific enzymatic cleavages in vivo yield mature proteins. Two signal peptidase-mediated cleavages within the polyprotein produce the structural proteins capsid, E2, and E1. The E2 signal peptide remains attached to the C-terminus of the capsid protein after cleavage by the signal peptidase. Another signal peptide at E2 C-terminus directs E1 to the ER, with a similar mechanism.. Spike glycoprotein E1. Contains three N-linked oligosaccharides.. Capsid is phosphorylated on Ser-46 by host. This phosphorylation negatively regulates capsid protein RNA-binding activity (By similarity). Dephosphorylated by human PP1A (By similarity).

Product protocols

Target data

Capsid protein. Capsid protein interacts with genomic RNA and assembles into icosahedric core particles 65-70 nm in diameter. The resulting nucleocapsid eventually associates with the cytoplasmic domain of E2 at the cell membrane, leading to budding and formation of mature virions from host Golgi membranes. Phosphorylation negatively regulates RNA-binding activity, possibly delaying virion assembly during the viral replication phase. Capsid protein dimerizes and becomes disulfide-linked in the virion. Modulates genomic RNA replication. Modulates subgenomic RNA synthesis by interacting with human C1QBP/SF2P32. Induces both perinuclear clustering of mitochondria and the formation of electron-dense intermitochondrial plaques, both hallmarks of rubella virus infected cells. Induces apoptosis when expressed in transfected cells.. Spike glycoprotein E2. Responsible for viral attachment to target host cell, by binding to the cell receptor. Its transport to the plasma membrane depends on interaction with E1 protein. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement.. Spike glycoprotein E1. Class II viral fusion protein (By similarity). Fusion activity is inactive as long as E1 is bound to E2 in mature virion. After virus attachment to target cell and clathrin-mediated endocytosis, acidification of the endosome would induce dissociation of E1/E2 heterodimer and concomitant trimerization of the E1 subunits (PubMed : 15557740). This E1 homotrimer is fusion active, and promotes release of viral nucleocapsid in cytoplasm after endosome and viral membrane fusion. The cytoplasmic tail of spike glycoprotein E1 modulates virus release. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement (By similarity).
See full target information Structural polyprotein

Additional targets

Rubella Virus capsid

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com