Overview

  • Product name

    Anti-Endofin antibody
  • Description

    Rabbit polyclonal to Endofin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Endofin aa 1-280.
    Sequence:

    MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASS QRTSLLPKDQECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGL DLLSSVDGGTSDEIQPLYMGRCSKPICDLISDMGNLVHATNSEEDIKKLL PDDFKSNADSLIGLDLSSVSDTPCVSSTDHDSDTVREQQNDISSELQNRE IGGIKELGIKVDTTLSDSYNYSGTENLKDKKIFNQLESIVDFNMSSALTR QSSKMFHAKDKLQHKSQPCGLLKDVGLVKE


    Database link: Q7Z3T8

  • Positive control

    • IHC-P: Human kidney and heart tissues. ICC/IF: HeLa cells.
  • General notes

    Previously labelled as ZFYVE16. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May be involved in regulating membrane trafficking in the endosomal pathway. Overexpression induces endosome aggregation. Required to target TOM1 to endosomes.
  • Tissue specificity

    Widely expressed. Highly expressed in kidney, placenta and lung. Expressed at intermediate level in heart, brain, skeletal muscle, spleen and liver. Weakly expressed in colon, thymus and peripheral blood lymphocytes.
  • Sequence similarities

    Contains 1 FYVE-type zinc finger.
  • Domain

    The FYVE-type zinc finger is necessary and sufficient for its localization into early endosomes and mediates the association with PI3P.
  • Cellular localization

    Cytoplasm. Early endosome membrane. Localized to early endosomes. Membrane-associated, probably via its association with phosphatidylinositol 3-phosphate.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI035632 antibody
    • B130024H06Rik antibody
    • B130031L15 antibody
    • DKFZp686E13162 antibody
    • Endofin antibody
    • Endosomal associated FYVE domain protein antibody
    • Endosome associated FYVE domain protein antibody
    • Endosome-associated FYVE domain protein antibody
    • KIAA0305 antibody
    • KIAA0305; antibody
    • mKIAA0305 antibody
    • OTTMUSP00000029589 antibody
    • RGD1564784 antibody
    • ZFY16_HUMAN antibody
    • ZFYVE16 antibody
    • Zinc finger FYVE domain containing protein 16 antibody
    • Zinc finger FYVE domain-containing protein 16 antibody
    • Zinc finger, FYVE domain containing 16 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Endofin (green) using ab234801 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human heart tissue stained for Endofin using ab234801 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Endofin using ab234801 at 1/100 dilution in immunohistochemical analysis.

References

ab234801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up