Overview

  • Product name

    Anti-ENDOGL1/ENGL antibody
    See all ENDOGL1/ENGL primary antibodies
  • Description

    Rabbit polyclonal to ENDOGL1/ENGL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ENDOGL1/ENGL aa 144-368.
    Sequence:

    AGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVW VVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEP LALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNI CSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYF MSRYEKKLEELKAKEQSGTQIRKPS


    Database link: Q9Y2C4-1

  • Positive control

    • IHC-P: Human breast cancer tissue.
  • General notes

     This product was previously labelled as ENDOGL1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab239065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Endo/exonuclease with nicking activity towards supercoiled DNA, a preference for single stranded DNA and 5'-3' exonuclease activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the DNA/RNA non-specific endonuclease family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Endo G like 1 antibody
    • Endo G-like 1 antibody
    • Endo/exonuclease (5'-3'), endonuclease G like antibody
    • ENDOGL 1 antibody
    • ENDOGL1 antibody
    • ENDOGL2 antibody
    • Endonuclease G like 1 antibody
    • Endonuclease G like 2 antibody
    • Endonuclease G-like 1 antibody
    • ENGL a antibody
    • ENGL antibody
    • ENGL B antibody
    • ENGLA antibody
    • ENGLB antibody
    • Exog antibody
    • EXOG_HUMAN antibody
    • MGC125944 antibody
    • MGC125945 antibody
    • mitochondrial antibody
    • Nuclease EXOG antibody
    • Nuclease EXOG mitochondrial antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for ENDOGL1/ENGL with ab239065 at a 1/100 dilution in immunohistochemical analysis.

References

ab239065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up