Overview

  • Product name

    Anti-Endostatin/COL18A1 antibody
    See all Endostatin/COL18A1 primary antibodies
  • Description

    Rabbit polyclonal to Endostatin/COL18A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Endostatin/COL18A1 aa 1600-1650 conjugated to keyhole limpet haemocyanin.
    Sequence:

    ADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDEL L


    Database link: P39060

  • Positive control

    • Human kidney carcinoma tissue.
  • General notes

    ab202973 binds in the region of Endostatin/COL18A1.

     This product was previously labelled as Endostatin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab202973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 178 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody).

Target

  • Function

    COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.
    Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
  • Tissue specificity

    Present in multiple organs with highest levels in liver, lung and kidney.
  • Involvement in disease

    Defects in COL18A1 are a cause of Knobloch syndrome (KNO) [MIM:267750]. KNO is an autosomal recessive disorder defined by the occurrence of high myopia, vitreoretinal degeneration with retinal detachment, macular abnormalities and occipital encephalocele.
  • Sequence similarities

    Belongs to the multiplexin collagen family.
    Contains 1 FZ (frizzled) domain.
    Contains 1 TSP N-terminal (TSPN) domain.
  • Post-translational
    modifications

    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha 1 collagen type 18 (XVIII)(COL18A1) antibody
    • Alpha 1 type XVIII collagen antibody
    • Antiangiogenic agent antibody
    • COIA1_HUMAN antibody
    • COL15A1 antibody
    • Col18a1 antibody
    • Collagen alpha 1(XV) chain antibody
    • Collagen alpha 1(XVIII) chain antibody
    • Collagen alpha-1(XV) chain antibody
    • Collagen type XV proteoglycan antibody
    • Collagen type XVIII alpha 1 antibody
    • Collagen XV, alpha 1 polypeptide antibody
    • Collagen, type XV, alpha 1 antibody
    • Endostatin antibody
    • Endostatin XV antibody
    • FLJ27325 antibody
    • FLJ34914 antibody
    • FLJ38566 antibody
    • KNO antibody
    • KNO1 antibody
    • KS antibody
    • MGC74745 antibody
    • Multi functional protein MFP antibody
    • OTTHUMP00000021782 antibody
    • OTTHUMP00000115472 antibody
    • OTTHUMP00000115473 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney carcinoma tissue labeling COL18A1 with ab202973 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab202973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up