Overview

  • Product name

    Anti-Endothelin 2/ET-2 antibody
    See all Endothelin 2/ET-2 primary antibodies
  • Description

    Rabbit polyclonal to Endothelin 2/ET-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Endothelin 2/ET-2 aa 92-176.
    Sequence:

    LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTG ELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR


    Database link: P20800

  • Positive control

    • WB: HEK-293T overexpressing Endothelin 2/ET-2 with a C-terminal myc-DDK tag, whole cell lysate. IHC-P: Human bone marrow tissue. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as Endothelin 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function

    Endothelins are endothelium-derived vasoconstrictor peptides.
  • Tissue specificity

    Expressed in lung, but not in placental stem villi vessels or cultured placental villi smooth muscle cells.
  • Sequence similarities

    Belongs to the endothelin/sarafotoxin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EDN2 antibody
    • EDN2_HUMAN antibody
    • Endothelin 2 antibody
    • Endothelin-2 antibody
    • ET 2 antibody
    • ET-2 antibody
    • ET2 antibody
    • PPET2 antibody
    • Preproendothelin 2 antibody
    • Preproendothelin-2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line)  cells stained for Endothelin 2/ET-2 (green) using ab246962 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human bone marrow tissue stained for Endothelin 2/ET-2 using ab246962 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-Endothelin 2/ET-2 antibody (ab246962) at 0.4 mg/ml

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HEK-293T overexpressing Endothelin 2/ET-2 with a C-terminal myc-DDK tag, whole cell lysate.

    Predicted band size: 20 kDa

References

ab246962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up