Overview

  • Product name

    Anti-Enkephalin/ENK antibody
    See all Enkephalin/ENK primary antibodies
  • Description

    Mouse polyclonal to Enkephalin/ENK
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Enkephalin/ENK aa 1-267.
    Sequence:

    MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADISFLACVM ECEGKLPSLKIWETCKELLQLSRPELPQDGTSTLRENSKPEESHLLAKRY GGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSL ANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLE DEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESY SKEVPEMEKRYGGFMRF


    Database link: AAH32505.1

  • Positive control

    • Leu + Met Enkephalin-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 31 kDa.

Target

  • Function

    Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum.
  • Sequence similarities

    Belongs to the opioid neuropeptide precursor family.
  • Post-translational
    modifications

    The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ENK antibody
    • Enkephalin A antibody
    • Enkephalin antibody
    • Met-enkephalin-Arg-Phe antibody
    • OGF antibody
    • Opioid growth factor antibody
    • PENK antibody
    • PENK_HUMAN antibody
    • Preproenkephalin antibody
    • Proenkephalin A antibody
    • Proenkephalin antibody
    see all

Images

  • All lanes : Anti-Enkephalin/ENK antibody (ab172085) at 1/500 dilution

    Lane 1 : Enkephalin-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 31 kDa

References

ab172085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up