Overview

  • Product name

  • Description

    Rabbit polyclonal to ENO3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human ENO3 aa 400-434 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    RSERLAKYNQLMRIEEALGDKAIFAGRKFRNPKAK


    Database link: P13929

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

WB 1/100 - 1/1000. Predicted molecular weight: 47 kDa.

Target

  • Function

    Appears to have a function in striated muscle development and regeneration.
  • Tissue specificity

    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Involvement in disease

    Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13) [MIM:612932]. A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen-beta particles are detected on ultrastructural analysis.
  • Sequence similarities

    Belongs to the enolase family.
  • Developmental stage

    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localization

    Cytoplasm. Localized to the Z line. Some colocalization with CKM at M-band.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 phospho D glycerate hydro lyase antibody
    • 2 phospho D glycerate hydrolyase antibody
    • 2-phospho-D-glycerate hydro-lyase antibody
    • Beta enolase antibody
    • Beta-enolase antibody
    • ENO3 antibody
    • ENOB_HUMAN antibody
    • Enolase 3 (beta muscle) antibody
    • Enolase 3 antibody
    • Enolase3 antibody
    • GSD13 antibody
    • MSE antibody
    • Muscle specific enolase antibody
    • Muscle-specific enolase antibody
    • Skeletal muscle enolase antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat brain tissue sections labeling ENO3 with ab203203 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up