Overview

  • Product name

    Anti-ENO4 antibody
  • Description

    Rabbit polyclonal to ENO4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ENO4 aa 61-145.
    Sequence:

    SKLAKPPTICKIVGKDVLDGLGLPTLQVDIFCTIQNFPKNVCSVVISTHF EVHENALPELAKAEEAERASAVSTAVQWVNSTITH


    Database link: A6NNW6

  • Positive control

    • Human fallopian tube tissue; RT4 and U251 MG lysates; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 69 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunofluorescent analysis of A431 cells (PFA-fixed/Triton X-100 permeabilized) labeling ENO4 with ab204433 at 4 μg/mL.

  • Immunohistochemical analysis of paraffin-embedded human fallopian tube tissue labeling ENO4 with ab204433 at 1/50 dilution.

  • All lanes : Anti-ENO4 antibody (ab204433) at 1/100 dilution

    Lane 1 : RT4 lysate
    Lane 2 : U251 MG lysate

    Developed using the ECL technique.

    Predicted band size: 69 kDa

References

ab204433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up