Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
Key features and details
- Mouse monoclonal [4C1H2] to ENPP3/B10
- Suitable for: WB, IHC-P, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-ENPP3/B10 antibody [4C1H2]
See all ENPP3/B10 primary antibodies -
Description
Mouse monoclonal [4C1H2] to ENPP3/B10 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, Flow Cytmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human ENPP3/B10 aa 45-163. (Expressed in E.coli)
Sequence:LRKLEKQGSCRKKCFDASFRGLENCRCDVACKDRGDCCWDFEDTCVESTR IWMCNKFRCGETRLEASLCSCSDDCLQRKDCCADYKSVCQGETSWLEENC DTAQQSQCPEGFDLPPVIL
Database link: O14638 -
Positive control
- WB: Human recombinant ENPP3/B10 (AA: extra 45-163) protein; ENPP3/B10 (AA: extra 45-163)-hIgGFc transfected HEK-293 cell lysate. Flow: HL-60 cells. IHC-P: Human renal cancer tissues.
-
General notes
This product was previously labelled as ENPP3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
4C1H2 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233777 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. | |
IHC-P | 1/200 - 1/1000. | |
Flow Cyt | 1/200 - 1/400. |
Target
-
Function
Cleaves a variety of phosphodiester and phosphosulfate bonds including deoxynucleotides, nucleotide sugars, and NAD. -
Tissue specificity
Expressed in bile ducts, prostate, uterus and colon. Exclusively expressed on basophils, mast cells and their progenitors. -
Sequence similarities
Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
Contains 2 SMB (somatomedin-B) domains. -
Post-translational
modificationsN-glycosylation is necessary for correct trafficking to the apical surface, but is not the apical targeting signal.
It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both. -
Cellular localization
Membrane. Secreted. Located to the apical surface in intestinal and kidney epithelial cells. Located to the cell surface of basophils, and to the apical plasma membrane of bile duct cells. Secreted in serum, and in lumen of epithelial cells. - Information by UniProt
-
Database links
- Entrez Gene: 5167 Human
- Entrez Gene: 5169 Human
- Entrez Gene: 100173734 Orangutan
- Omim: 602182 Human
- SwissProt: O14638 Human
- SwissProt: P22413 Human
- SwissProt: Q5R5M5 Orangutan
- Unigene: 486489 Human
see all -
Alternative names
- Alkaline phosphodiesterase I antibody
- ARHR2 antibody
- B10 antibody
see all
Images
-
Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling ENPP3/B10 using ab233777 at 1/200 dilution (green) and the negative control (red).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
Paraffin-embedded human renal cancer tissue stained for ENPP3/B10 using ab233777 at 1/200 dilution in immunohistochemical analysis. DAB staining.
-
All lanes : Anti-ENPP3/B10 antibody [4C1H2] (ab233777) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
Lane 2 : ENPP3/B10 (AA: extra 45-163)-hIgGFc transfected HEK-293 cell lysate. -
Anti-ENPP3/B10 antibody [4C1H2] (ab233777) at 1/500 dilution + Human recombinant ENPP3/B10 (AA: extra 45-163) protein.
Expected MW is 13.6 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab233777 has been referenced in 1 publication.
- Sakamoto S et al. Multiplexed single-molecule enzyme activity analysis for counting disease-related proteins in biological samples. Sci Adv 6:eaay0888 (2020). PubMed: 32195342