For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    enpp3b10-antibody-4c1h2-ab233777.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA / Nucleotides
Share by email

Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Flow Cytometry - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
  • Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
  • Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

Key features and details

  • Mouse monoclonal [4C1H2] to ENPP3/B10
  • Suitable for: WB, IHC-P, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Human ENPP3/B10 protein (ab159085)
Primary
Product image
PE Anti-ENPP3/B10 antibody [NP4D6] (ab90751)

View more associated products

Overview

  • Product name

    Anti-ENPP3/B10 antibody [4C1H2]
    See all ENPP3/B10 primary antibodies
  • Description

    Mouse monoclonal [4C1H2] to ENPP3/B10
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ENPP3/B10 aa 45-163. (Expressed in E.coli)
    Sequence:

    LRKLEKQGSCRKKCFDASFRGLENCRCDVACKDRGDCCWDFEDTCVESTR IWMCNKFRCGETRLEASLCSCSDDCLQRKDCCADYKSVCQGETSWLEENC DTAQQSQCPEGFDLPPVIL


    Database link: O14638
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Human recombinant ENPP3/B10 (AA: extra 45-163) protein; ENPP3/B10 (AA: extra 45-163)-hIgGFc transfected HEK-293 cell lysate. Flow: HL-60 cells. IHC-P: Human renal cancer tissues.
  • General notes

     This product was previously labelled as ENPP3

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    4C1H2
  • Isotype

    IgG1
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA / Nucleotides
    • Signal Transduction
    • Metabolism
    • Plasma Membrane
    • ATPases
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Nucleotide metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Recombinant Protein

    • Recombinant Human ENPP3/B10 protein (ab159085)

Applications

Our Abpromise guarantee covers the use of ab233777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Cleaves a variety of phosphodiester and phosphosulfate bonds including deoxynucleotides, nucleotide sugars, and NAD.
  • Tissue specificity

    Expressed in bile ducts, prostate, uterus and colon. Exclusively expressed on basophils, mast cells and their progenitors.
  • Sequence similarities

    Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
    Contains 2 SMB (somatomedin-B) domains.
  • Post-translational
    modifications

    N-glycosylation is necessary for correct trafficking to the apical surface, but is not the apical targeting signal.
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
  • Cellular localization

    Membrane. Secreted. Located to the apical surface in intestinal and kidney epithelial cells. Located to the cell surface of basophils, and to the apical plasma membrane of bile duct cells. Secreted in serum, and in lumen of epithelial cells.
  • Target information above from: UniProt accession O14638 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 5167 Human
    • Entrez Gene: 5169 Human
    • Entrez Gene: 100173734 Orangutan
    • Omim: 602182 Human
    • SwissProt: O14638 Human
    • SwissProt: P22413 Human
    • SwissProt: Q5R5M5 Orangutan
    • Unigene: 486489 Human
    • Unigene: 527295 Human
    see all
  • Alternative names

    • Alkaline phosphodiesterase I antibody
    • ARHR2 antibody
    • B10 antibody
    • CD203c antibody
    • CD203c antigen antibody
    • dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) antibody
    • dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) antibody
    • E NPP 3 antibody
    • E-NPP 3 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase 3 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 antibody
    • ENPP3 antibody
    • ENPP3_HUMAN antibody
    • gp130RB13 6 antibody
    • gp130RB136 antibody
    • M6S1 antibody
    • NPP1 antibody
    • NPP3 antibody
    • NPPase antibody
    • NPPS antibody
    • Nucleotide pyrophosphatase antibody
    • PC 1 antibody
    • PC-1 antibody
    • PCA1 antibody
    • PD Ibeta antibody
    • PD-Ibeta antibody
    • PDNP1 antibody
    • PDNP3 antibody
    • Phosphodiesterase I beta antibody
    • Phosphodiesterase I/nucleotide pyrophosphatase 3 antibody
    • phosphodiesterase i/nucleotide pyrophosphatase beta antibody
    see all

Images

  • Flow Cytometry - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Flow Cytometry - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

    Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling ENPP3/B10 using ab233777 at 1/200 dilution (green) and the negative control (red).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

    Paraffin-embedded human renal cancer tissue stained for ENPP3/B10 using ab233777 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    All lanes : Anti-ENPP3/B10 antibody [4C1H2] (ab233777) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
    Lane 2 : ENPP3/B10 (AA: extra 45-163)-hIgGFc transfected HEK-293 cell lysate.
  • Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Anti-ENPP3/B10 antibody [4C1H2] (ab233777) at 1/500 dilution + Human recombinant ENPP3/B10 (AA: extra 45-163) protein.


    Expected MW is 13.6 kDa.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab233777? Please let us know so that we can cite the reference in this datasheet.

    ab233777 has been referenced in 1 publication.

    • Sakamoto S  et al. Multiplexed single-molecule enzyme activity analysis for counting disease-related proteins in biological samples. Sci Adv 6:eaay0888 (2020). PubMed: 32195342

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab233777.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.