Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

Submit a review Submit a question

Overview

  • Product name

    Anti-ENPP3/B10 antibody [4C1H2]
    See all ENPP3/B10 primary antibodies

  • Description

    Mouse monoclonal [4C1H2] to ENPP3/B10

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan

  • Immunogen

    Recombinant fragment corresponding to Human ENPP3/B10 aa 45-163. (Expressed in E.coli)
    Sequence:

    LRKLEKQGSCRKKCFDASFRGLENCRCDVACKDRGDCCWDFEDTCVESTR IWMCNKFRCGETRLEASLCSCSDDCLQRKDCCADYKSVCQGETSWLEENC DTAQQSQCPEGFDLPPVIL


    Database link: O14638

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Human recombinant ENPP3/B10 (AA: extra 45-163) protein; ENPP3/B10 (AA: extra 45-163)-hIgGFc transfected HEK-293 cell lysate. Flow: HL-60 cells. IHC-P: Human renal cancer tissues.

  • General notes

     This product was previously labelled as ENPP3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Cleaves a variety of phosphodiester and phosphosulfate bonds including deoxynucleotides, nucleotide sugars, and NAD.

  • Tissue specificity

    Expressed in bile ducts, prostate, uterus and colon. Exclusively expressed on basophils, mast cells and their progenitors.

  • Sequence similarities

    Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
    Contains 2 SMB (somatomedin-B) domains.

  • Post-translational
    modifications

    N-glycosylation is necessary for correct trafficking to the apical surface, but is not the apical targeting signal.
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.

  • Cellular localization

    Membrane. Secreted. Located to the apical surface in intestinal and kidney epithelial cells. Located to the cell surface of basophils, and to the apical plasma membrane of bile duct cells. Secreted in serum, and in lumen of epithelial cells.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • Alkaline phosphodiesterase I antibody
    • ARHR2 antibody
    • B10 antibody
    • CD203c antibody
    • CD203c antigen antibody
    • dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) antibody
    • dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) antibody
    • E NPP 3 antibody
    • E-NPP 3 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase 3 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 antibody
    • ENPP3 antibody
    • ENPP3_HUMAN antibody
    • gp130RB13 6 antibody
    • gp130RB136 antibody
    • M6S1 antibody
    • NPP1 antibody
    • NPP3 antibody
    • NPPase antibody
    • NPPS antibody
    • Nucleotide pyrophosphatase antibody
    • PC 1 antibody
    • PC-1 antibody
    • PCA1 antibody
    • PD Ibeta antibody
    • PD-Ibeta antibody
    • PDNP1 antibody
    • PDNP3 antibody
    • Phosphodiesterase I beta antibody
    • Phosphodiesterase I/nucleotide pyrophosphatase 3 antibody
    • phosphodiesterase i/nucleotide pyrophosphatase beta antibody
    see all

Images

  • Flow Cytometry - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Flow Cytometry - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

    Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling ENPP3/B10 using ab233777 at 1/200 dilution (green) and the negative control (red).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)

    Paraffin-embedded human renal cancer tissue stained for ENPP3/B10 using ab233777 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    All lanes : Anti-ENPP3/B10 antibody [4C1H2] (ab233777) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
    Lane 2 : ENPP3/B10 (AA: extra 45-163)-hIgGFc transfected HEK-293 cell lysate.
  • Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Western blot - Anti-ENPP3/B10 antibody [4C1H2] (ab233777)
    Anti-ENPP3/B10 antibody [4C1H2] (ab233777) at 1/500 dilution + Human recombinant ENPP3/B10 (AA: extra 45-163) protein.


    Expected MW is 13.6 kDa.

References

ab233777 has not yet been referenced specifically in any publications.

Publishing research using ab233777? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab233777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com