Overview

  • Product name

  • Description

    Rabbit polyclonal to ENPP6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ENPP6 aa 24-120.
    Sequence:

    RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYP NYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS


    Database link: Q6UWR7

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase, which hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5 prime-monophosphate. It hydrolyzes lysophosphatidylcholine (LPC) to form monoacylglycerol and phosphorylcholine but not lysophosphatidic acid, showing it has a lysophospholipase C activity. ENPP6 has a preference for LPC with short (12:0 and 14:0) or polyunsaturated (18:2 and 20:4) fatty acids. ENPP6 also hydrolyzes glycerophosphorylcholine and sphingosylphosphorylcholine efficiently. ENPP6 is predominantly expressed in kidney and brain.
  • Cellular localization

    Cell membrane; Single-pass type I membrane protein. Secreted. Note: A minor secreted form also exists.
  • Database links

  • Alternative names

    • B830047L21Rik antibody
    • E-NPP 6 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase 6 antibody
    • ectonucleotide pyrophosphatase/phosphodiesterase family member 6 antibody
    • ENPP 6 antibody
    • NPP 6 antibody
    • NPP6 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for ENPP6 using ab224564 at 1/20 dilution in immunohistochemical analysis.

References

ab224564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up