Anti-ENSA antibody (ab14297)
- Datasheet
- References (1)
- Protocols
Overview
-
Product nameAnti-ENSA antibody
See all ENSA primary antibodies -
DescriptionChicken polyclonal to ENSA
-
Host speciesChicken
-
Tested applicationsSuitable for: WBmore details
-
Species reactivityReacts with: Mouse, Rat, Cow, Human
-
Immunogen
Full length protein corresponding to Human ENSA aa 1-121.
Sequence:MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGG SDFLMKRLQK GQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIP TPQDLPQRKSSLVTSKLAGGQV E
-
General notesDuring shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container's cap.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
-
Storage bufferConstituent: PBS
-
Concentration information loading... -
PurityImmunogen affinity purified
-
ClonalityPolyclonal
-
IsotypeIgY
-
Research areas
Applications
Our Abpromise guarantee covers the use of ab14297 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/2000. Predicted molecular weight: 15 kDa. |
Target
-
RelevanceENSA (Alpha endosulfine) is expressed in a wide range of tissues including muscle, brain, and endocrine tissues. The recombinant protein inhibits binding of labeled glibenclamide to beta cell membranes. It also inhibits cloned K(ATP) channel currents and thereby stimulates insulin secretion. It was proposed that endosulfine is an endogenous regulator of the K(ATP) channel, which has a key role in the control of insulin release and, more generally, couples cell metabolism to electrical activity.
-
Cellular localizationCytoplasmic
-
Database links
- Entrez Gene: 281142 Cow
- Entrez Gene: 2029 Human
- Entrez Gene: 56205 Mouse
- Entrez Gene: 60334 Rat
- Omim: 603061 Human
- SwissProt: O43768 Human
- SwissProt: P60840 Mouse
- SwissProt: P60841 Rat
see all -
Alternative names
- Alpha endosulfine antibody
- ARPP 19e antibody
- Endosulfine alpha antibody
Images
-
Western blot - Anti-ENSA antibody (ab14297)Anti-ENSA antibody (ab14297) at 1/2000 dilution + E.coli derived ENSA fusion protein as test antigen.
Secondary
HRP conjugated goat anti IgY at 1/1000 dilution
Predicted band size: 15 kDa
Datasheets and documents
Protocols
References
This product has been referenced in:
- Woods WS et al. Conformation-specific binding of alpha-synuclein to novel protein partners detected by phage display and NMR spectroscopy. J Biol Chem 282:34555-67 (2007). WB ; Human . Read more (PubMed: 17893145) »
