Anti-ENSA antibody (ab14297)
Key features and details
- Chicken polyclonal to ENSA
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgY
Overview
-
Product name
Anti-ENSA antibody
See all ENSA primary antibodies -
Description
Chicken polyclonal to ENSA -
Host species
Chicken -
Tested Applications & Species
Application Species WB Recombinant fragment -
Immunogen
Full length protein corresponding to Human ENSA aa 1-121.
Sequence:MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGG SDFLMKRLQK GQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIP TPQDLPQRKSSLVTSKLAGGQV E
-
General notes
During shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container's cap.The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgY -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab14297 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
WB |
Recombinant fragment
|
Application | Abreviews | Notes |
---|---|---|
WB |
1/1000 - 1/2000. Predicted molecular weight: 15 kDa.
|
Notes |
---|
WB
1/1000 - 1/2000. Predicted molecular weight: 15 kDa. |
Target
-
Relevance
ENSA (Alpha endosulfine) is expressed in a wide range of tissues including muscle, brain, and endocrine tissues. The recombinant protein inhibits binding of labeled glibenclamide to beta cell membranes. It also inhibits cloned K(ATP) channel currents and thereby stimulates insulin secretion. It was proposed that endosulfine is an endogenous regulator of the K(ATP) channel, which has a key role in the control of insulin release and, more generally, couples cell metabolism to electrical activity. -
Cellular localization
Cytoplasmic -
Alternative names
- Alpha endosulfine antibody
- ARPP 19e antibody
- Endosulfine alpha antibody
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab14297 has been referenced in 1 publication.
- Woods WS et al. Conformation-specific binding of alpha-synuclein to novel protein partners detected by phage display and NMR spectroscopy. J Biol Chem 282:34555-67 (2007). WB ; Human . PubMed: 17893145