Overview

  • Product name

  • Description

    Rabbit polyclonal to ENTPD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ENTPD3 aa 83-139.
    Sequence:

    TGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGST PIHLGAT


    Database link: O75355

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Has a threefold preference for the hydrolysis of ATP over ADP.
  • Tissue specificity

    Expressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the GDA1/CD39 NTPase family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATPDase antibody
    • CD39 antigen like 3 antibody
    • CD39 antigen-like 3 antibody
    • CD39 like 3 antibody
    • CD39L3 antibody
    • Ecto apyrase antibody
    • Ecto ATP diphosphohydrolase antibody
    • Ecto-apyrase 3 antibody
    • Ecto-ATP diphosphohydrolase 3 antibody
    • Ecto-ATPase 3 antibody
    • Ecto-ATPDase 3 antibody
    • Ectonucleoside triphosphate diphosphohydrolase 3 antibody
    • ENTP3_HUMAN antibody
    • ENTPD 3 antibody
    • ENTPD3 antibody
    • FLJ93839 antibody
    • HB 6 antibody
    • HB6 antibody
    • NTPDase 3 antibody
    • NTPDase3 antibody
    • OTTHUMP00000162079 antibody
    • OTTHUMP00000209227 antibody
    • OTTHUMP00000209228 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ENTPD3 (green) using ab221875 at 4 ug/ml in ICC/IF.

References

ab221875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up