Overview

  • Product name
  • Description
    Rabbit polyclonal to ENTPD7
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ENTPD7 aa 51-350.
    Sequence:

    HWSASLPRDRQYERYLARVGELEATDTEDPNLNYGLVVDCGSSGSRIFVY FWPRHNGNPHDLLDIKQMRDRNSQPVVKKIKPGISAMADTPEHASDYLRP LLSFAAAHVPVKKHKETPLYILCTAGMRLLPERKQLAILADLVKDLPLEF DFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDAEATQELAAGR RRTVGILDMGGASLQIAYEVPTSTSVLPAKQEEAAKILLAEFNLGCDVQH TEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNP


    Database link: Q9NQZ7

  • Positive control
    • WB: HeLa whole cell lysate; Mouse heart, spleen, lung and kidney lysates. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 69 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-ENTPD7 antibody (ab236644) at 1/2000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse heart lysate
    Lane 3 : Mouse spleen lysate
    Lane 4 : Mouse lung lysate
    Lane 5 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 69 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ENTPD7 (green) using ab236644 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up