Overview

  • Product name

    Anti-Eosinophil derived neurotoxin antibody
    See all Eosinophil derived neurotoxin primary antibodies
  • Description

    Rabbit polyclonal to Eosinophil derived neurotoxin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Eosinophil derived neurotoxin aa 28-161. Mature full-length chain without the signal peptide.
    Sequence:

    KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFAN VVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQ TPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII


    Database link: P10153

  • Positive control

    • IHC-P: Human kidney and spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Eosinophil derived neurotoxin (EDN) is a protein belonging to the ribonuclease (RNase) A superfamily. It has recently been found to have antiviral activity against respiratory syncytial virus and human immunodeficiency virus in vitro.
  • Cellular localization

    Lysosome (Probable). Cytoplasmic granule. Matrix of eosinophil's large specific granule.
  • Database links

  • Alternative names

    • Ear4 antibody
    • EC=3.1.27.5 antibody
    • EDN antibody
    • Eosinophil cationic type ribonuclease 4 antibody
    • MR 4 antibody
    • Non secretory ribonuclease antibody
    • R14 antibody
    • R15 antibody
    • R5 antibody
    • Ribonuclease 2 antibody
    • Ribonuclease RNase A family 2 (liver eosinophil derived neurotoxin) antibody
    • Ribonuclease US antibody
    • RNase 2 antibody
    • RNase UpI 2 antibody
    • RNASE2 antibody
    • RNS2 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Eosinophil derived neurotoxin using ab238562 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for Eosinophil derived neurotoxin using ab238562 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab238562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up