Overview

  • Product name

  • Description

    Rabbit polyclonal to Eotaxin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human Eotaxin 2 aa 50-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    YQLSSRSTCLKAGVIFTTKKGQQFCGDPKQE


    Database link: O00175

  • Positive control

    • Mouse stomach and small intestine tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.
  • Tissue specificity

    Activated monocytes and activated T lymphocytes.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C C motif chemokine 24 antibody
    • C-C motif chemokine 24 antibody
    • CCL24 antibody
    • CCL24_HUMAN antibody
    • Chemokine CC Motif Ligand 24 antibody
    • CK beta 6 antibody
    • CK-beta-6 antibody
    • Ckb6 antibody
    • Eosinophil chemotactic protein 2 antibody
    • Eotaxin-2 antibody
    • MPIF 2 antibody
    • MPIF-2 antibody
    • MPIF2 antibody
    • Myeloid progenitor inhibitory factor 2 antibody
    • SCYA24 antibody
    • Small inducible cytokine A24 antibody
    • Small inducible cytokine subfamily A (Cys-Cys) member 24 antibody
    • Small-inducible cytokine A24 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse stomach tissue labeling Eotaxin 2 with ab203586 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse small intestine tissue labeling Eotaxin 2 with ab203586 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up