Overview

  • Product name

    Anti-Eotaxin antibody (Biotin)
    See all Eotaxin primary antibodies
  • Description

    Goat polyclonal to Eotaxin (Biotin)
  • Host species

    Goat
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: Sandwich ELISA, WBmore details
  • Species reactivity


    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Eotaxin aa 24-97. Produced in E. coli. Full length mature chain without signal peptide.
    Sequence:

    GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP


    Database link: 51671

  • Positive control

    • WB: Recombinant human Eotaxin protein. sELISA: Recombinant human Eotaxin protein.

Properties

  • Form

    Lyophilised:Reconstitute in sterile PBS + 0.1% BSA to 0.1-1.0mg/ml.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.20
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab245855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 11 kDa.

No endogenous data, tested with recombinant protein only.

Target

  • Function

    In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    O-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-C motif chemokine 11 antibody
    • CCL 11 antibody
    • CCL11 antibody
    • CCL11_HUMAN antibody
    • chemokine (C-C motif) ligand 11 antibody
    • Chemokine C C motif ligand 11 antibody
    • Chemokine CC Motif Ligand 11 antibody
    • Chemokine ligand 11 antibody
    • Eosinophil chemotactic protein antibody
    • Eotaxin antibody
    • eotaxin-1 antibody
    • MGC22554 antibody
    • SCYA 11 antibody
    • SCYA11 antibody
    • Small inducible cytokine A11 antibody
    • Small inducible cytokine subfamily A (Cys Cys) member 11 antibody
    • small inducible cytokine subfamily A (Cys-Cys), member 11 (eotaxin) antibody
    • Small inducible cytokine subfamily A member 11 antibody
    • Small-inducible cytokine A11 antibody
    see all

Images

  • To detect human Eotaxin by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant human Eotaxin is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lane 1: Marker.

    Lanes 2-12: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng/ml respectively.

  • To detect human Eotaxin by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of this antibody is required.

    This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human Eotaxin.

References

ab245855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up