Overview

  • Product name

  • Description

    Rabbit polyclonal to EPB41L1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EPB41L1 aa 617-714.
    Sequence:

    EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAP SQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE


    Database link: Q9H4G0

  • Positive control

    • WB:RT4 cell lysate. IHC-P: Human cerebral cortex, adrenal gland, kidney and colon tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 99 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May function to confer stability and plasticity to neuronal membrane via multiple interactions, including the spectrin-actin-based cytoskeleton, integral membrane channels and membrane-associated guanylate kinases.
  • Tissue specificity

    Highest expression in brain, lower in heart, kidney, pancreas, placenta, lung and skeletal muscle.
  • Sequence similarities

    Contains 1 FERM domain.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4.1N antibody
    • Band 4.1 like protein 1 antibody
    • Band 4.1-like protein 1 antibody
    • DKFZp686H17242 antibody
    • E41L1_HUMAN antibody
    • EPB41L 1 antibody
    • Epb41l1 antibody
    • Erythrocyte membrane protein band 4.1 like 1 antibody
    • KIAA0338 antibody
    • MGC11072 antibody
    • MRD11 antibody
    • Neuron type nonerythroid protein 4.1 antibody
    • Neuronal protein 4.1 antibody
    • Nonerythroid protein 4.1 antibody
    • Nonerythroid protein 4.1, neuron type antibody
    • OTTHUMP00000030825 antibody
    • OTTHUMP00000030826 antibody
    • OTTHUMP00000030827 antibody
    • OTTHUMP00000030829 antibody
    see all

Images

  • All lanes : Anti-EPB41L1 antibody (ab244499) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 99 kDa

  • Paraffin-embedded human colon tissue stained for EPB41L1 using ab244499 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human kidney tissue stained for EPB41L1 using ab244499 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human adrenal gland tissue stained for EPB41L1 using ab244499 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human cerebral cortex tissue stained for EPB41L1 using ab244499 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for EPB41L1 using ab244499 at 1/200 dilution in immunohistochemical analysis.  Low expression, as expected.

  • PFA-fixed, Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells stained for EPB41L1 (green) using ab244499 at 4 μg/ml in ICC/IF.

References

ab244499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up