Overview

  • Product name

    Anti-EPCR/CD201 antibody [OTI12H5]
    See all EPCR/CD201 primary antibodies
  • Description

    Mouse monoclonal [OTI12H5] to EPCR/CD201
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EPCR/CD201 aa 1-210. Produced in HEK-293T cells (NP_006395).
    Sequence:

    MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASL GGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLV HQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALW QADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTK GSQTSRSYTS


    Database link: Q9UNN8

  • Positive control

    • WB: pCMV6-ENTRY EPCR/CD201 cDNA transfected HEK-293T cell lysate. IHC-P: Human breast, colon, colon adenocarcinoma, lung, endometrium, prostate and bladder tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 27 kDa.
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes

Target

  • Function

    Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
  • Tissue specificity

    Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney.
  • Post-translational
    modifications

    N-glycosylated.
    A soluble form exists; probably released by a metalloprotease. Seems to have the same activity as the membrane-bound form.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activated protein C receptor antibody
    • APC receptor antibody
    • APCR antibody
    • bA42O4.2 antibody
    • CCCA antibody
    • CCD41 antibody
    • CD201 antibody
    • CD201 antigen antibody
    • cell cycle, centrosome-associated protein antibody
    • Cell cycle, centrosome-associated protein antibody
    • centrocyclin antibody
    • Endothelial cell protein C receptor antibody
    • Endothelial protein C receptor antibody
    • EPCR antibody
    • EPCR_HUMAN antibody
    • MGC23024 antibody
    • PROCR antibody
    • Protein C receptor, endothelial antibody
    see all

Images

  • All lanes : Anti-EPCR/CD201 antibody [OTI12H5] (ab236517) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY EPCR/CD201 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 27 kDa

  • Paraffin-embedded human breast tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder tissue stained for EPCR/CD201 using ab236517 at 1/150 dilution in immunohistochemical analysis.

References

ab236517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up