Anti-Eph receptor A7/EPHA7 antibody (ab204113)
Key features and details
- Rabbit polyclonal to Eph receptor A7/EPHA7
- Suitable for: IHC-P, Flow Cyt
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-Eph receptor A7/EPHA7 antibody
See all Eph receptor A7/EPHA7 primary antibodies -
Description
Rabbit polyclonal to Eph receptor A7/EPHA7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human -
Immunogen
Synthetic peptide within Human Eph receptor A7/EPHA7 aa 203-253 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:KKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSA E
Database link: Q15375 -
Positive control
- Mouse embryo tissue; rat brain and testis tissues; mouse spleen cells.
-
General notes
This product was previously labelled as Eph receptor A7
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab204113 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. When using a fluorescent probe the recommended dilution is 1/50 – 1/200. |
|
Flow Cyt | 1/20 - 1/100. |
Target
-
Function
Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A2, -A3, -A4 and -A5. -
Tissue specificity
Widely expressed. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Contains 2 fibronectin type-III domains.
Contains 1 protein kinase domain.
Contains 1 SAM (sterile alpha motif) domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2045 Human
- Entrez Gene: 13841 Mouse
- Entrez Gene: 171287 Rat
- Omim: 602190 Human
- SwissProt: Q15375 Human
- SwissProt: Q61772 Mouse
- SwissProt: P54759 Rat
- Unigene: 73962 Human
see all -
Alternative names
- Cek 11 antibody
- Developmental kinase 1 antibody
- EBK antibody
see all
Images
-
Flow cytometric analysis of Mouse spleen cells labeling Eph receptor A7/EPHA7 with ab204113 at 1/50 dilution for 60 minutes followed by incubation with Goat Anti-Rabbit IgG FITC conjugated secondary at 1/100 (green) for 40 minutes compared to control cells (blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat testis tissue labeling Eph receptor A7/EPHA7 with ab204113
at 1/200 dilution overnight at 4°C followed by Goat Anti-Rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling Eph receptor A7/EPHA7 with ab204113 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse embryo tissue labeling Eph receptor A7/EPHA7 with ab204113 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References (0)
ab204113 has not yet been referenced specifically in any publications.