For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    eph-receptor-a7epha7-antibody-ab204113.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Ephrins Eph Receptors
Share by email

Anti-Eph receptor A7/EPHA7 antibody (ab204113)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Flow Cytometry - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)

Key features and details

  • Rabbit polyclonal to Eph receptor A7/EPHA7
  • Suitable for: IHC-P, Flow Cyt
  • Reacts with: Mouse, Rat
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Eph receptor A7/EPHA7 antibody
    See all Eph receptor A7/EPHA7 primary antibodies
  • Description

    Rabbit polyclonal to Eph receptor A7/EPHA7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human Eph receptor A7/EPHA7 aa 203-253 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSA E


    Database link: Q15375
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Mouse embryo tissue; rat brain and testis tissues; mouse spleen cells.
  • General notes

     This product was previously labelled as Eph receptor A7

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Ephrins
    • Eph Receptors
    • Neuroscience
    • Neurotransmission
    • Intracellular Signaling
    • Kinases
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Growth Cone
    • Neuroscience
    • Neurology process
    • Growth and Development
    • Axonal Guidance Proteins
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Tyrosine Kinase Receptors

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human Eph receptor A7/EPHA7 protein (ab174075)
  • Related Products

    • Recombinant Human Eph receptor A7/EPHA7 protein (ab174075)

Applications

Our Abpromise guarantee covers the use of ab204113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Flow Cyt 1/20 - 1/100.

Target

  • Function

    Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A2, -A3, -A4 and -A5.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession Q15375 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2045 Human
    • Entrez Gene: 13841 Mouse
    • Entrez Gene: 171287 Rat
    • Omim: 602190 Human
    • SwissProt: Q15375 Human
    • SwissProt: Q61772 Mouse
    • SwissProt: P54759 Rat
    • Unigene: 73962 Human
    • Unigene: 257266 Mouse
    • Unigene: 10181 Rat
    see all
  • Alternative names

    • Cek 11 antibody
    • Developmental kinase 1 antibody
    • EBK antibody
    • EHK-3 antibody
    • EHK3 antibody
    • EK11 antibody
    • Embryonic brain kinase antibody
    • EPH homology kinase 3 antibody
    • EPH-like kinase 11 antibody
    • Epha7 antibody
    • EPHA7_HUMAN antibody
    • Ephrin receptor Eph A7 antibody
    • Ephrin type A receptor 7 antibody
    • Ephrin type-A receptor 7 antibody
    • hEK11 antibody
    • MDK 1 antibody
    • Receptor protein tyrosine kinase HEK 11 antibody
    • Tyrosine protein kinase receptor EHK 3 antibody
    see all

Images

  • Flow Cytometry - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
    Flow Cytometry - Anti-Eph receptor A7/EPHA7 antibody (ab204113)

    Flow cytometric analysis of Mouse spleen cells labeling Eph receptor A7/EPHA7 with ab204113 at 1/50 dilution for 60 minutes followed by incubation with Goat Anti-Rabbit IgG FITC conjugated secondary at 1/100 (green) for 40 minutes compared to control cells (blue).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat testis tissue labeling Eph receptor A7/EPHA7 with ab204113

    at 1/200 dilution overnight at 4°C followed by Goat Anti-Rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling Eph receptor A7/EPHA7 with ab204113 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse embryo tissue labeling Eph receptor A7/EPHA7 with ab204113 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

Protocols

  • Flow cytometry protocols
  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab204113? Please let us know so that we can cite the reference in this datasheet.

    ab204113 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab204113.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.