Anti-Eph receptor A7/EPHA7 antibody (ab204113)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Eph receptor A7/EPHA7 antibody
See all Eph receptor A7/EPHA7 primary antibodies -
Description
Rabbit polyclonal to Eph receptor A7/EPHA7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human Eph receptor A7/EPHA7 aa 203-253 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:KKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSA E
Database link: Q15375 -
Positive control
- Mouse embryo tissue; rat brain and testis tissues; mouse spleen cells.
-
General notes
This product was previously labelled as Eph receptor A7
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab204113 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. When using a fluorescent probe the recommended dilution is 1/50 – 1/200. |
|
| Flow Cyt | 1/20 - 1/100. |
Target
-
Function
Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A2, -A3, -A4 and -A5. -
Tissue specificity
Widely expressed. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Contains 2 fibronectin type-III domains.
Contains 1 protein kinase domain.
Contains 1 SAM (sterile alpha motif) domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2045 Human
- Entrez Gene: 13841 Mouse
- Entrez Gene: 171287 Rat
- Omim: 602190 Human
- SwissProt: Q15375 Human
- SwissProt: Q61772 Mouse
- SwissProt: P54759 Rat
- Unigene: 73962 Human
see all -
Alternative names
- Cek 11 antibody
- Developmental kinase 1 antibody
- EBK antibody
see all
Images
-
Flow Cytometry - Anti-Eph receptor A7/EPHA7 antibody (ab204113)Flow cytometric analysis of Mouse spleen cells labeling Eph receptor A7/EPHA7 with ab204113 at 1/50 dilution for 60 minutes followed by incubation with Goat Anti-Rabbit IgG FITC conjugated secondary at 1/100 (green) for 40 minutes compared to control cells (blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat testis tissue labeling Eph receptor A7/EPHA7 with ab204113
at 1/200 dilution overnight at 4°C followed by Goat Anti-Rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling Eph receptor A7/EPHA7 with ab204113 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eph receptor A7/EPHA7 antibody (ab204113)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse embryo tissue labeling Eph receptor A7/EPHA7 with ab204113 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References
ab204113 has not yet been referenced specifically in any publications.
