Overview

  • Product name

  • Description

    Rabbit polyclonal to Ephexin-5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ephexin-5 aa 123-202.
    Sequence:

    PSGSPCTPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPE PGLQARADVNGEREAPLTGSGSQENGAPDA


    Database link: O94989

  • Positive control

    • HUVEC TERT2 cells.
  • General notes

    Previously labelled as Rho guanine exchange factor 15.

Properties

Applications

Our Abpromise guarantee covers the use of ab221376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Specific GEF for RhoA activation. Does not activate RAC1 or CDC42. Regulates vascular smooth muscle contractility. Negatively regulates excitatory synapse development by suppressing the synapse-promoting activity of EPHB2.
  • Tissue specificity

    Expressed in the vascular smooth muscle of coronary artery.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues upon EFNA1 stimulation.
    Phosphorylation at Tyr-353 by EPHB2 triggers ubiquitination and degradation by the proteasome which promotes EFNB1-dependent synapse formation.
  • Cellular localization

    Cell projection > dendrite. Expressed exclusively in dendrites of the developing hippocampus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARGEF15 antibody
    • ARHGEF15 antibody
    • ARHGF_HUMAN antibody
    • E5 antibody
    • Ephexin-5 antibody
    • Ephexin5 antibody
    • FLJ13791 antibody
    • KIAA0915 antibody
    • MGC44868 antibody
    • Rho guanine exchange factor 15 antibody
    • Rho guanine nucleotide exchange factor (GEF) 15 antibody
    • Rho guanine nucleotide exchange factor 15 antibody
    • Vsm RhoGEF antibody
    • Vsm-RhoGEF antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HUVEC TERT2 cells labeling Ephexin-5 with ab221376 at 4 μg/ml (green). 

References

ab221376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up