For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ephrin-a2-antibody-oti3e3-ab123877.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Ephrins Ephrins
Share by email

Anti-Ephrin A2 antibody [OTI3E3] (ab123877)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
  • Western blot - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
  • Flow Cytometry - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)

Key features and details

  • Mouse monoclonal [OTI3E3] to Ephrin A2
  • Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
  • Reacts with: Human
  • Isotype: IgG2b

You may also be interested in

Protein
Product image
Recombinant Human Ephrin A2 protein (ab114898)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-Ephrin A2 antibody [OTI3E3]
  • Description

    Mouse monoclonal [OTI3E3] to Ephrin A2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Ephrin A2 aa 1-213. Produced in HEK293T cells (NP_001396).
    Sequence:

    MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS


    Database link: O43921
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK293T cells transfected pCMV6-ENTRY Ephrin A2 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF:COS7 cells transiently transfected by pCMV6-ENTRY Ephrin A2. Flow: Jurkat cells.
  • General notes

    The clone number has been updated from 3E3 to OTI3E3, both clone numbers name the same clone.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography
  • Clonality

    Monoclonal
  • Clone number

    OTI3E3
  • Isotype

    IgG2b
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Ephrins
    • Ephrins
    • Neuroscience
    • Neurotransmission
    • Intracellular Signaling
    • Kinases
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Growth Cone
    • Neuroscience
    • Neurology process
    • Growth and Development
    • Axonal Guidance Proteins
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Tyrosine Kinase Receptors

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG2b, kappa monoclonal [7E10G10] - Isotype Control (ab170192)
  • Recombinant Protein

    • Recombinant Human Ephrin A2 protein (ab114898)

Applications

Our Abpromise guarantee covers the use of ab123877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 24 kDa.
IHC-P 1/150.
Flow Cyt 1/100.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/100.

Target

  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession O43921 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1943 Human
    • Omim: 602756 Human
    • SwissProt: O43921 Human
    • Unigene: 532655 Human
    • Alternative names

      • EFNA 2 antibody
      • efna2 antibody
      • EFNA2_HUMAN antibody
      • ELF1 antibody
      • Eph related receptor tyrosine kinase ligand 6 antibody
      • EPH-related receptor tyrosine kinase ligand 6 antibody
      • Ephrin-A2 antibody
      • EphrinA2 antibody
      • EPLG6 antibody
      • HEK7 L antibody
      • HEK7 ligand antibody
      • HEK7-L antibody
      • HEK7L antibody
      • LERK 6 antibody
      • LERK-6 antibody
      • LERK6 antibody
      • Ligand of eph related kinase 6 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
      Immunocytochemistry/ Immunofluorescence - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)

      COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY Ephrin A2, stained for Epherin A2 (Green) using ab123877 at 1/100 dilution in ICC/IF.

    • Western blot - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
      Western blot - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
      All lanes : Anti-Ephrin A2 antibody [OTI3E3] (ab123877) at 1/2000 dilution

      Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
      Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY Ephrin A2 cDNA

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 24 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)

      Paraffin-embedded human endometrium tissue stained for Ephrin A2 using ab123877 at 1/100 dilution in immunohistochemical analysis.

       

    • Flow Cytometry - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
      Flow Cytometry - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
      ab123877 at 1/100 dilution staining Ephrin-A2 in Jurkat cells by Flow cytometry (Red) compared to a nonspecific negative control antibody (Blue).

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab123877? Please let us know so that we can cite the reference in this datasheet.

    ab123877 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab123877.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.