Anti-Ephrin A2 antibody [OTI3E3] (ab123877)

Overview

  • Product name
    Anti-Ephrin A2 antibody [OTI3E3]
    See all Ephrin A2 primary antibodies
  • Description
    Mouse monoclonal [OTI3E3] to Ephrin A2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Ephrin A2 aa 1-213. Produced in HEK293T cells (NP_001396).
    Sequence:

    MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS


    Database link: O43921

  • Positive control
    • WB: HEK293T cells transfected pCMV6-ENTRY Ephrin A2 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF:COS7 cells transiently transfected by pCMV6-ENTRY Ephrin A2. Flow: Jurkat cells.
  • General notes

    The clone number has been updated from 3E3 to OTI3E3, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab123877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 24 kDa.
IHC-P 1/150.
Flow Cyt 1/100.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/100.

Target

  • Sequence similarities
    Belongs to the ephrin family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • EFNA 2 antibody
    • efna2 antibody
    • EFNA2_HUMAN antibody
    • ELF1 antibody
    • Eph related receptor tyrosine kinase ligand 6 antibody
    • EPH-related receptor tyrosine kinase ligand 6 antibody
    • Ephrin-A2 antibody
    • EphrinA2 antibody
    • EPLG6 antibody
    • HEK7 L antibody
    • HEK7 ligand antibody
    • HEK7-L antibody
    • HEK7L antibody
    • LERK 6 antibody
    • LERK-6 antibody
    • LERK6 antibody
    • Ligand of eph related kinase 6 antibody
    see all

Images

  • All lanes : Anti-Ephrin A2 antibody [OTI3E3] (ab123877) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY Ephrin A2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 24 kDa

  • Paraffin-embedded human endometrium tissue stained for Ephrin A2 using ab123877 at 1/100 dilution in immunohistochemical analysis.

     

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY Ephrin A2, stained for Epherin A2 (Green) using ab123877 at 1/100 dilution in ICC/IF.

  • ab123877 at 1/100 dilution staining Ephrin-A2 in Jurkat cells by Flow cytometry (Red) compared to a nonspecific negative control antibody (Blue).

References

ab123877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up