Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
Key features and details
- Mouse monoclonal [OTI3E3] to Ephrin A2
- Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Ephrin A2 antibody [OTI3E3] -
Description
Mouse monoclonal [OTI3E3] to Ephrin A2 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Ephrin A2 aa 1-213. Produced in HEK293T cells (NP_001396).
Sequence:MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
Database link: O43921 -
Positive control
- WB: HEK293T cells transfected pCMV6-ENTRY Ephrin A2 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF:COS7 cells transiently transfected by pCMV6-ENTRY Ephrin A2. Flow: Jurkat cells.
-
General notes
The clone number has been updated from 3E3 to OTI3E3, both clone numbers name the same clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI3E3 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab123877 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000. Predicted molecular weight: 24 kDa. | |
IHC-P | 1/150. | |
Flow Cyt | 1/100. ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
|
|
ICC/IF | 1/100. |
Target
-
Sequence similarities
Belongs to the ephrin family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1943 Human
- Omim: 602756 Human
- SwissProt: O43921 Human
- Unigene: 532655 Human
-
Alternative names
- EFNA 2 antibody
- efna2 antibody
- EFNA2_HUMAN antibody
see all
Images
-
COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY Ephrin A2, stained for Epherin A2 (Green) using ab123877 at 1/100 dilution in ICC/IF.
-
All lanes : Anti-Ephrin A2 antibody [OTI3E3] (ab123877) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY Ephrin A2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 24 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
Paraffin-embedded human endometrium tissue stained for Ephrin A2 using ab123877 at 1/100 dilution in immunohistochemical analysis.
-
ab123877 at 1/100 dilution staining Ephrin-A2 in Jurkat cells by Flow cytometry (Red) compared to a nonspecific negative control antibody (Blue).
Protocols
Datasheets and documents
References (0)
ab123877 has not yet been referenced specifically in any publications.