Overview

  • Product name

  • Description

    Rabbit polyclonal to Ephrin A4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse Ephrin A4 aa 1-206. Expressed in E. coli. N-terminal His-tag and GST-tag.
    Sequence:

    MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGF NDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCS MPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRL QVSVCCKESGSSHESAHPVGSPGESGTSGWRGGHAPSPLCLLLLLLLPIL RLLRVL


    Database link: O08542

  • Positive control

    • WB: Recombinant mouse Ephrin A4 protein. Mouse spleen, ovary and thymus tissue lysate. IHC-P: Mouse liver and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function

    May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.
  • Tissue specificity

    Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EFL 4 antibody
    • EFL4 antibody
    • EFN A4 antibody
    • EFNA 4 antibody
    • EFNA4 antibody
    • EFNA4_HUMAN antibody
    • Eph related receptor tyrosine kinase ligand 4 antibody
    • EPH-related receptor tyrosine kinase ligand 4 antibody
    • Ephrin-A4 antibody
    • EphrinA4 antibody
    • EPLG 4 antibody
    • EPLG4 antibody
    • LERK 4 antibody
    • LERK-4 antibody
    • LERK4 antibody
    • Ligand of Eph related kinase 4 antibody
    • MGC125826 antibody
    see all

Images

  • All lanes : Anti-Ephrin A4 antibody (ab232711) at 3 µg/ml

    Lane 1 : Mouse spleen tissue lysate
    Lane 2 : Mouse ovary tissue lysate
    Lane 3 : Mouse thymus tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 23 kDa

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for Ephrin A4 with ab232711 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for Ephrin A4 with ab232711 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Ephrin A4 antibody (ab232711) at 3 µg/ml + Recombinant mouse Ephrin A4 protein

    Predicted band size: 23 kDa

References

ab232711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up