Overview

  • Product name

  • Description

    Rabbit polyclonal to Ephrin B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Ephrin B1 aa 164-222.
    Sequence:

    VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVN QEEKSGPGA


    Database link: P98172

  • Positive control

    • ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
  • Tissue specificity

    Heart, placenta, lung, liver, skeletal muscle, kidney, pancreas.
  • Involvement in disease

    Defects in EFNB1 are a cause of craniofrontonasal syndrome (CFNS) [MIM:304110]; also known as craniofrontonasal dysplasia (CFND). CFNS is an X-linked inherited syndrome characterized by hypertelorism, coronal synostosis with brachycephaly, downslanting palpebral fissures, clefting of the nasal tip, joint anomalies, longitudinally grooved fingernails and other digital anomalies.
  • Sequence similarities

    Belongs to the ephrin family.
  • Post-translational
    modifications

    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CFND antibody
    • CFNS antibody
    • Craniofrontonasal syndrome (craniofrontonasal dysplasia) antibody
    • EFL 3 antibody
    • EFL-3 antibody
    • EFL3 antibody
    • EFNB1 antibody
    • EFNB1_HUMAN antibody
    • Elk L antibody
    • ELK ligand antibody
    • ELK-L antibody
    • Eph related receptor tyrosine kinase ligand 2 antibody
    • EPH-related receptor tyrosine kinase ligand 2 antibody
    • Ephrin-B1 antibody
    • EPLG2 antibody
    • LERK 2 antibody
    • LERK-2 antibody
    • LERK2 antibody
    • Ligand of eph related kinase 2 antibody
    • MGC8782 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for Ephrin B1 (green) using ab221652 at 4 µg/ml in ICC/IF.

References

ab221652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up