Overview

  • Product name

    Anti-EPI64 antibody - C-terminal
    See all EPI64 primary antibodies
  • Description

    Rabbit polyclonal to EPI64 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Cow, Cat, Pig, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human EPI64 aa 458-508 (C terminal). The exact sequence is proprietary. NP_114143.1
    Sequence:

    AAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTY L


    Database link: Q9BXI6

  • Positive control

    • Whole cell lysate from HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH3T3 cells.
  • General notes

    Previously labelled as TBC1D10A.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Acts as GTPase-activating protein for RAB27A, but not for RAB2A, RAB3A, nor RAB4A.
  • Sequence similarities

    Contains 1 Rab-GAP TBC domain.
  • Post-translational
    modifications

    Exists in both phosphorylated and non-phosphorylated state.
  • Cellular localization

    Cell projection > microvillus. Localizes to the microvilli-rich region of the syncytiotrophoblast. In melanocytes, located at the periphery of cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ130H16.1 antibody
    • dJ130H16.2 antibody
    • EBP50 PDZ interactor of 64 kD antibody
    • EBP50-PDX interactor of 64 kDa antibody
    • EPI 64 antibody
    • EPI64 antibody
    • EPI64 protein antibody
    • Rab27A-GAP-alpha antibody
    • TB10A_HUMAN antibody
    • TBC1 domain family member 10A antibody
    • TBC1D10 antibody
    • TBC1D10A antibody
    see all

Images

  • All lanes : Anti-EPI64 antibody - C-terminal (ab194945) at 0.1 µg/ml

    Lane 1 : Whole cell lysate from HeLa
    Lane 2 : Whole cell lysate from 293T
    Lane 3 : Whole cell lysate from Jurkat
    Lane 4 : Whole cell lysate from TCMK-1
    Lane 5 : Whole cell lysate from NIH 3T3

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 3 minutes
  • Detection of Human EPI64 by Western Blot of Immunoprecipitates.

    Lane 1: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using NETN lysis buffer. ab194945 was used for IP at 6 μg per reaction, and at 0.4 μg/ml for blotting.

    Lane 2: Control IgG.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab194945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up