Overview

  • Product name

    Anti-epithelial Sodium Channel alpha antibody
  • Description

    Rabbit polyclonal to epithelial Sodium Channel alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human epithelial Sodium Channel alpha aa 200-250 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVR E


    Database link: P37088

  • Positive control

    • Human kidney and rat kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab214192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 77 kDa (predicted molecular weight: 76 kDa).
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Tissue specificity

    Highly expressed in kidney and lung. Detected at intermediate levels in pancreas and liver, and at low levels in heart and placenta. Isoform 1 and isoform 2 predominate in all tissues. Expression of isoform 3, isoform 4 and isoform 5 is very low or not detectable, except in lung and heart.
  • Involvement in disease

    Defects in SCNN1A are a cause of autosomal recessive pseudohypoaldosteronism type 1 (AR-PHA1) [MIM:264350]. PHA1 is a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. There are 2 forms of PHA1: the autosomal recessive form that is severe, and the dominant form which is milder and due to defects in mineralocorticoid receptor. AR-PHA1 is characterized by an often fulminant presentation in the neonatal period with dehydration, hyponatraemia, hyperkalaemia, metabolic acidosis, failure to thrive and weight loss. Note=The degree of channel function impairment differentially affects the renin-aldosterone system and urinary Na/K ratios, resulting in distinct genotype-phenotype relationships in PHA1 patients. Loss-of-function mutations are associated with a severe clinical course and age-dependent hyperactivation of the renin-aldosterone system. This feature is not observed in patients with missense mutations that reduce but do not eliminate channel function. Markedly reduced channel activity results in impaired linear growth and delayed puberty.
    Defects in SCNN1A are a cause of bronchiectasis with or without elevated sweat chloride type 2 (BESC2) [MIM:613021]; also called cystic fibrosis-like syndrome. BESC2 is a debilitating respiratory disease characterized by chronic abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include subnormal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases.
  • Sequence similarities

    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1A subfamily.
  • Post-translational
    modifications

    Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation.
  • Cellular localization

    Apical cell membrane. Apical membrane of epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha ENaC 2 antibody
    • Alpha ENaC antibody
    • Alpha NaCH antibody
    • Alpha-ENaC antibody
    • Alpha-NaCH antibody
    • Amiloride sensitive epithelial sodium channel alpha subunit antibody
    • Amiloride sensitive sodium channel subunit alpha antibody
    • Amiloride-sensitive sodium channel subunit alpha antibody
    • ENaCA antibody
    • ENaCalpha antibody
    • Epithelial Na(+) channel subunit alpha antibody
    • Epithelial Na+ channel subunit alpha antibody
    • FLJ21883 antibody
    • Nonvoltage gated sodium channel 1 subunit alpha antibody
    • Nonvoltage-gated sodium channel 1 subunit alpha antibody
    • SCNEA antibody
    • SCNN 1 antibody
    • SCNN1 antibody
    • Scnn1a antibody
    • SCNNA_HUMAN antibody
    • Sodium channel nonvoltage gated 1 alpha antibody
    see all

Images

  • Mouse kidney lysate (40 ug)

    Primary: ab214192 at 1/1000 dilution

    Secondary: IRDye800CW Goat anti-Rabbit IgG at 1/20000 dilution

    Predicted band size: 76 kD

    Observed band size: 77 kD

  • Rat kidney lysate (40 ug)

    Primary: ab214192 at 1/1000 dilution

    Secondary: IRDye800CW Goat anti-Rabbit IgG at 1/20000 dilution

    Predicted band size: 76 kD

    Observed band size: 77 kD

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded Human kidney tissue labeling epithelial Sodium Channel alpha with ab214192 at 1/200 dilution followed by a conjugated secondary and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat kidney tissue labeling epithelial Sodium Channel alpha with ab214192 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab214192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up