Overview

  • Product name

    Anti-EPM2A, isoform 9 antibody
  • Description

    Rabbit polyclonal to EPM2A, isoform 9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human EPM2A, isoform 9 aa 1-331.
    Sequence:

    MHPKEGAEQHVFSPVPGAPTPPPNRCGRLVLGPRLPAAGTPGPGIRAAAA RHALPLWGGGATRRGRRPAGAAGGGVAARAGALGAARCRPPEAGRHRGGR RGPGPAGAGPVARGGGAGGRGGGAGRGGAGPRGHVLVQVPEAGAGRRALL GRYCQQTPAPGAERELRPAPPTGASASGRPRRPRRRASRAFCPRPCALPG RPGLTLLCRPRCRRQPRLRLPTDSLDPYSAPGRLPAHSVACPSDLVSAHP VLSFFPTAPASRASALRLPPGAPFALRVPLDLRVPPFAGPLAARPRAADG FNSPTPPWLGFVSSFSCSNSLKKTQNDPTNE


    Database link: B3EWF7

  • Positive control

    • WB: Mouse skeletal muscle tissue lysate. IHC-P: Human brain tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab229934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000. Predicted molecular weight: 36 kDa.

Images

  • Anti-EPM2A, isoform 9 antibody (ab229934) at 1/2000 dilution + Mouse skeletal muscle tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa

  • Paraffin-embedded human brain tissue stained for EPM2A, isoform 9 using ab229934 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for EPM2A, isoform 9 (green) using ab229934 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488-conjugated Goat anti-Rabbit IgG (H+L) as secondary antibody.

References

ab229934 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229934.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up