Overview

  • Product name

    Anti-epsilon Tubulin antibody
  • Description

    Rabbit polyclonal to epsilon Tubulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 179-228 (

    PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

    ) of Human epsilon Tubulin (NP_057346).

  • Positive control

    • MCF7 cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-epsilon Tubulin antibody (ab98833) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size: 53 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Dunleavy JEM  et al. Katanin-like 2 (KATNAL2) functions in multiple aspects of haploid male germ cell development in the mouse. PLoS Genet 13:e1007078 (2017). Read more (PubMed: 29136647) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

I have compared the sequence you sent to the immunogen sequence of ab98833 and ab11322 and neither of them have a high enough degree of similarity to your sequence of interest that I would be confident in recommending them to you. You could try looking at biocompare.com to see if there are any other antibodies that may suit your needs.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up