Overview

  • Product name

  • Description

    Rabbit polyclonal to Epsin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Epsin 1 aa 241-308.
    Sequence:

    AIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAA PTSDPWGGPPVPPAADPW


    Database link: Q9Y6I3

  • Positive control

    • HEK 293 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab221075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100

 

Target

  • Function

    Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Modifies membrane curvature and facilitates the formation of clathrin-coated invaginations (By similarity). Regulates receptor-mediated endocytosis.
  • Sequence similarities

    Belongs to the epsin family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 3 UIM (ubiquitin-interacting motif) repeats.
  • Domain

    The NPF repeat domain is involved in EPS15 binding.
    The DPW repeat domain is involved in AP2A2 and clathrin binding.
    The [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif mediates interaction with the AP-2 complex subunit AP2B1.
  • Post-translational
    modifications

    Phosphorylated on serine and/or threonine residues in mitotic cells. Phosphorylation reduces interaction with REPS2, AP-2 and the membrane fraction. Depolarization of synaptosomes results in dephosphorylation.
    Ubiquitinated.
  • Cellular localization

    Cytoplasm. Cell membrane. Nucleus. Membrane > clathrin-coated pit. Associated with the cytoplasmic membrane at sites where clathrin-coated pits are forming. Colocalizes with clathrin and AP-2 in a punctate pattern on the plasma membrane. Detected in presynaptic nerve terminals and in Golgi stacks. May shuttle to the nucleus when associated with ZBTB16/ZNF145.
  • Information by UniProt
  • Database links

  • Alternative names

    • EH domain binding mitotic phosphoprotein antibody
    • EH domain-binding mitotic phosphoprotein antibody
    • EPN 1 antibody
    • Epn1 antibody
    • EPN1_HUMAN antibody
    • EPS 15 interacting protein 1 antibody
    • EPS-15-interacting protein 1 antibody
    • Epsin 1 antibody
    • Epsin-1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, Triton X-100 permeabilized HEK 293 cells labeling Epsin 1 with ab221075 at 4 µg/ml (green).

     

References

ab221075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up