Overview

  • Product name

  • Description

    Rabbit polyclonal to EPSTI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human EPSTI1 aa 73-280. (Expressed in E.coli).
    Sequence:

    NINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQK QQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMKAIQREKSNKLEEKKR LQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSAVCGPQSSTWKLP ILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQE RAKIHQTE


    Database link: Q96J88

  • Positive control

    • WB: MCF7 cell lysate; Pig small intestine lysate; Recombinant human EPSTI1 protein. IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as Epithelial Stromal Interaction 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Tissue specificity

    Highly expressed in placenta, small intestine, spleen, kidney, thymus, liver, salivary gland and testes. Weakly expressed in breast, skeletal muscle and colon. Highly expressed in breast cancer upon interaction between tumor cells and stromal cells in vitro. Expressed in blood mononuclear cells from patients with systemic lupus erythematosus (SLE).
  • Information by UniProt
  • Database links

  • Alternative names

    • BRESI 1 antibody
    • BRESI1 antibody
    • Epithelial stromal interaction 1 (breast) antibody
    • Epithelial stromal interaction protein 1 (breast) antibody
    • Epithelial stromal interaction protein 1 antibody
    • Epithelial-stromal interaction protein 1 antibody
    • EPSTI 1 antibody
    • Epsti1 antibody
    • ESIP1_HUMAN antibody
    • MGC29634 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for EPSTI1 using ab233036 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-EPSTI1 antibody (ab233036) at 2 µg/ml + Pig small intestine lysate

    Predicted band size: 37 kDa

  • Anti-EPSTI1 antibody (ab233036) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 37 kDa

  • Anti-EPSTI1 antibody (ab233036) at 2 µg/ml + Recombinant human EPSTI1 protein

    Predicted band size: 37 kDa

References

ab233036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up