Overview

  • Product name

  • Description

    Rabbit polyclonal to ERAB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ERAB aa 2-261.
    Sequence:

    AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQA KKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTY NLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVII NTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLF GTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVI RLDGAIRMQP


    Database link: Q99714

  • Positive control

    • WB: HEK-293T, HepG2, HeLa, Jurkat and HT-29 whole cell lysates; Mouse brain lysate. IP: HEK-293T whole cell lysate. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 27 kDa.
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.

Target

  • Function

    Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD).
  • Tissue specificity

    Expressed in normal tissues but is overexpressed in neurons affected in AD.
  • Involvement in disease

    Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) [MIM:300438]. MHBD deficiency leads to neurological abnormalities, including psychomotor retardation, and, in virtually all patients, loss of mental and motor skills.
    Defects in HSD17B10 are the cause of mental retardation syndromic X-linked type 10 (MRXS10) [MIM:300220]. MRXS10 is characterized by mild mental retardation, choreoathetosis and abnormal behavior.
    A chromosomal microduplication involving HSD17B10 and HUWE1 is the cause of mental retardation X-linked type 17 (MRX17) [MIM:300705]; also known as mental retardation X-linked type 31 (MRX31). Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific X-linked mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 17 beta hydroxysteroid dehydrogenase 10 antibody
    • 17 beta hydroxysteroid dehydrogenase type 10 antibody
    • 17-beta-HSD 10 antibody
    • 17-beta-hydroxysteroid dehydrogenase 10 antibody
    • 17b HSD10 antibody
    • 3 hydroxy 2 methylbutyryl CoA dehydrogenase antibody
    • 3 hydroxyacyl CoA dehydrogenase type 2 antibody
    • 3 hydroxyacyl CoA dehydrogenase type II antibody
    • 3-hydroxy-2-methylbutyryl-CoA dehydrogenase antibody
    • 3-hydroxyacyl-CoA dehydrogenase type II antibody
    • 3-hydroxyacyl-CoA dehydrogenase type-2 antibody
    • AB binding alcohol dehydrogenase antibody
    • ABAD antibody
    • Ads9 antibody
    • Amyloid beta binding polypeptide antibody
    • Amyloid beta peptide binding alcohol dehydrogenase antibody
    • Amyloid beta peptide binding protein antibody
    • Amyloid beta peptide binding protein antibody
    • CAMR antibody
    • DUPXp11.22 antibody
    • Endoplasmic Reticulum Amyloid Binding Protein antibody
    • Endoplasmic reticulum associated amyloid beta peptide binding protein antibody
    • Endoplasmic reticulum-associated amyloid beta-peptide-binding protein antibody
    • ER associated amyloid beta-binding protein antibody
    • ERAB antibody
    • HADH 2 antibody
    • HADH2 antibody
    • HCD 2 antibody
    • HCD2 antibody
    • HCD2_HUMAN antibody
    • Hsd17b10 antibody
    • Hydroxyacyl CoA Dehydrogenase type II antibody
    • Hydroxyacyl Coenzyme A dehydrogenase type II antibody
    • Hydroxysteroid (17 beta) dehydrogenase 10 antibody
    • Mental retardation X linked syndromic 11 antibody
    • MHBD antibody
    • Mitochondrial L3 Hydroxyacyl CoA Dehydrogenase antibody
    • Mitochondrial ribonuclease P protein 2 antibody
    • Mitochondrial RNase P protein 2 antibody
    • MRPP2 antibody
    • MRX17 antibody
    • SCHAD antibody
    • SDR5C1 antibody
    • Short chain dehydrogenase/reductase family 5C member 1 antibody
    • Short chain L 3 hydroxyacyl CoA dehydrogenase type 2 antibody
    • Short chain type dehydrogenase/reductase XH98G2 antibody
    • Short-chain type dehydrogenase/reductase XH98G2 antibody
    • Type 10 17b HSD antibody
    • Type 10 17beta hydroxysteroid dehydrogenase antibody
    • Type II HADH antibody
    • XH98G2 antibody
    see all

Images

  • All lanes : Anti-ERAB antibody (ab237806) at 1/1000 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : HeLa (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 5 : HT-29 (human colorectal adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 27 kDa

  • A549 (human lung carcinoma cell line) cells stained for ERAB (green) using ab237806 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

     

  • All lanes : Anti-ERAB antibody (ab237806) at 1/1000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa

  • ERAB was immunoprecipitated from 0.5 mg HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract with ab237806 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP in HEK-293T whole cell lysate.

    Lane 2: ab237806 IP in HEK-293T whole cell lysate.

    Lane 3: HEK-293T whole cell lysate 10 μg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab237806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up