Overview

  • Product name

    Anti-ERCC1 antibody [1E5B3]
    See all ERCC1 primary antibodies
  • Description

    Mouse monoclonal [1E5B3] to ERCC1
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ERCC1 aa 151-297. (Purified from E.coli).
    Sequence:

    DYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAW SPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDS QTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP


    Database link: P07992

  • Positive control

    • Human ERCC1 (aa151-297) recombinant protein; ERCC1 (aa151-297)-hIgGFc transfected HEK293 cell lysate; HeLa and A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.
  • Involvement in disease

    Defects in ERCC1 are the cause of cerebro-oculo-facio-skeletal syndrome type 4 (COFS4) [MIM:610758]. COFS is a degenerative autosomal recessive disorder of prenatal onset affecting the brain, eye and spinal cord. After birth, it leads to brain atrophy, hypoplasia of the corpus callosum, hypotonia, cataracts, microcornea, optic atrophy, progressive joint contractures and growth failure. Facial dysmorphism is a constant feature. Abnormalities of the skull, eyes, limbs, heart and kidney also occur.
  • Sequence similarities

    Belongs to the ERCC1/RAD10/SWI10 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • COFS 4 antibody
    • COFS4 antibody
    • DNA excision repair protein ERCC 1 antibody
    • DNA excision repair protein ERCC-1 antibody
    • DNA excision repair protein ERCC1 antibody
    • ERCC 1 antibody
    • ERCC1 antibody
    • ERCC1_HUMAN antibody
    • Excision repair cross complementation group 1 antibody
    • Excision repair cross complementing 1 antibody
    • Excision Repair Cross Complementing Rodent Repair Deficiency Complementation Group 1 antibody
    • Excision repair protein antibody
    • RAD 10 antibody
    • RAD10 antibody
    • UV 20 antibody
    • UV20 antibody
    see all

Images

  • Anti-ERCC1 antibody [1E5B3] (ab204988) at 1/500 dilution + Human ERCC1 (aa151-297) recombinant protein

    Predicted band size: 33 kDa



    Expected MWt is 42.5 kDa.

  • All lanes : Anti-ERCC1 antibody [1E5B3] (ab204988) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : ERCC1 (aa151-297)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 33 kDa

  • Immunofluorescent analysis of HeLa cells labeling ERCC1 with ab204988 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.

  • Flow cytometric analysis of A549 cells labeling ERCC1 with ab204988 at 1/200 dilution (green), compared to a negative control (red).

References

ab204988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up