Overview

  • Product name

  • Description

    Rabbit polyclonal to EREG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human EREG aa 30-169. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    VLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHG QCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILIILF LITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV


    Database link: O14944

  • Positive control

    • WB: Recombinant human EREG protein; Human placenta tissue lysate. Human and mouse lymphocytes cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • All lanes : Anti-EREG antibody (ab233512) at 2 µg/ml

    Lane 1 : Human placenta tissue lysate
    Lane 2 : Human lymphocyte cell lysate
    Lane 3 : Mouse lymphocyte cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-EREG antibody (ab233512) at 2 µg/ml + Recombinant human EREG protein

References

ab233512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up