Anti-ERFE/Erythroferrone antibody (ab222468)

Overview

  • Product name

    Anti-ERFE/Erythroferrone antibody
  • Description

    Rabbit polyclonal to ERFE/Erythroferrone
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ERFE/Erythroferrone aa 67-113.
    Sequence:

    EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP


    Database link: Q4G0M1

  • Positive control

    • ICC/IF: RH-30 (human bone marrow metastasis cell line) cells.
  • General notes

     This product was previously labelled as ERFE

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage: produced by erythroblasts following blood loss and mediates suppression of hepcidin (HAMP) expression in the liver, thereby promoting increased iron absorption and mobilization from stores. Promotes lipid uptake into adipocytes and hepatocytes via transcriptional up-regulation of genes involved in fatty acid uptake.
  • Sequence similarities

    Belongs to the adipolin/erythroferrone family.
    Contains 1 C1q domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complement C1q tumor necrosis factor-related protein 15 antibody
    • ERFE_HUMAN antibody
    • Erythroferrone antibody
    • FAM132B antibody
    • Myonectin antibody
    see all

Images

  • PFA fixed/ Triton X-100 permeabilized RH-30 (human bone marrow metastasis cell line) cells stained for ERFE/Erythroferrone (green) using ab222468 at 4 µg/ml in ICC/IF.

References

ab222468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Erythroid cell line)
Gel Running Conditions
Non-reduced Denaturing (8)
Loading amount
20 µg
Specification
Erythroid cell line
Blocking step
Milk as blocking agent for 10 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Feb 28 2018

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Erythroblast)
Permeabilization
No
Specification
Erythroblast
Blocking step
Bloxall Blocking Solution #SP-6000 Vector Labs as blocking agent for 10 minute(s) · Concentration: 100% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Feb 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up