Overview

  • Product name

  • Description

    Rabbit polyclonal to ERGIC2/PTX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ERGIC2/PTX1 aa 55-310.
    Sequence:

    YQDTWMKYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASA DGLVYEPTVFDLSPQQKEWQRMLQLIQSRLQEEHSLQDVIFKSAFKSTST ALPPREDDSSQSPNACRIHGHLYVNKVAGNFHITVGKAIPHPRGHAHLAA LVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIAIDHNQMFQYFITVV PTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLMVTV TEEHMP


    Database link: Q96RQ1

  • Positive control

    • WB: HeLa whole cell lysate; Rat and mouse brain tissue lysates. IHC-P: Human lung cancer and pancreas tissues. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as ERGIC2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/5000. Predicted molecular weight: 43 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Possible role in transport between endoplasmic reticulum and Golgi.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the ERGIC family.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Endoplasmic reticulum membrane. Cytoplasm. Nucleus. Cycles between the endoplasmic reticulum and the Golgi. PubMed:11445006 states that it localizes to the nucleus; PubMed:17980171 shows a partial localization in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • cd002 antibody
    • CD14 protein antibody
    • CDA14 antibody
    • Endoplasmic reticulum Golgi intermediate compartment protein 2 antibody
    • Endoplasmic reticulum-Golgi intermediate compartment protein 2 antibody
    • ERGI2_HUMAN antibody
    • ERGIC 2 antibody
    • ERGIC and golgi 2 antibody
    • ergic2 antibody
    • Erv41 antibody
    • MGC111152 antibody
    • PTX1 antibody
    • PTX1 protein antibody
    see all

Images

  • All lanes : Anti-ERGIC2/PTX1 antibody (ab237761) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Rat brain tissue lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

  • Paraffin-embedded human pancreas tissue stained for ERGIC2/PTX1 with ab237761 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human lung cancer tissue stained for ERGIC2/PTX1 with ab237761 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ERGIC2/PTX1 using ab237761 at 1/100 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

References

ab237761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up