Overview

  • Product name

  • Description

    Rabbit polyclonal to ERGIC2/PTX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human ERGIC2/PTX1 aa 1-50 (N terminal).
    Sequence:

    MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIM


    (Peptide available as ab86285)

  • Positive control

    • HepG2 cell lysate
  • General notes

     This product was previously labelled as ERGIC2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab50847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 48 kDa (predicted molecular weight: 43 kDa).Can be blocked with Human ERGIC2/PTX1 peptide (ab86285). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Possible role in transport between endoplasmic reticulum and Golgi.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the ERGIC family.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Endoplasmic reticulum membrane. Cytoplasm. Nucleus. Cycles between the endoplasmic reticulum and the Golgi. PubMed:11445006 states that it localizes to the nucleus; PubMed:17980171 shows a partial localization in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • cd002 antibody
    • CD14 protein antibody
    • CDA14 antibody
    • Endoplasmic reticulum Golgi intermediate compartment protein 2 antibody
    • Endoplasmic reticulum-Golgi intermediate compartment protein 2 antibody
    • ERGI2_HUMAN antibody
    • ERGIC 2 antibody
    • ERGIC and golgi 2 antibody
    • ergic2 antibody
    • Erv41 antibody
    • MGC111152 antibody
    • PTX1 antibody
    • PTX1 protein antibody
    see all

Images

  • Anti-ERGIC2/PTX1 antibody (ab50847) at 2.5 µg/ml + HepG2 Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa
    Observed band size: 48 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement of ab7817 (excahnge for the original product ab50847) as you requested with the order number 1099763.

To check the status of the order please contact our Customer Service team and reference this number.

Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know.

I wish you the best of luck with your research.

Read More

Answer

Thank you for getting back to me and for providing some useful details. I am sorry to hear that the antibody is not performing this time as it is supposed to do.

If you have had past good results with this antibody, we may be able to offer a new vial from another lot. If you are interested in a replacement, we can send you this but need to liaise with the Lab. In case you would prefer to get a refund, we can arrange it for you as well without any problem.


Please do let me know how you wish to proceed. I look forward to hearing from you soon.

Read More

Answer

I am sorry to hear that you have been experiencing problems using this product in the application that you wish.

In order to assess the quality of our products I would ask that you complete a brief questionnaire relating to the application used. Often it is possible to make suggestions that may help resolve problems experienced using a particular product.

As our Abpromise indicates, in the event that a product is not functioning in the applications/species cited on the product data sheet (and the problem has been reported within 6 months of purchase) we will happily offer a credit note/refund to the value of the product purchased.

Could you provide some further details of the protocol used and complete the following form (attached as a word document for Western blot application).

How have you selected the sequence of siRNA? Have you tried more than one SiRNA sequence? Could you check if the sequence corresponds correctly toERGIC2 protein?
Have you checked the transfection efficiency and optimized the length of time for knockout to take effect?
Have you checked the transfection by fluorescence tags and the knockout by RT-PCR?
Have you used the correct endogenous positive and negative controls? Have you applied scrambled siRNA or standard negative siRNA controls?
Could you please specify the type of the KO (targeted, untargeted, induced KO, tissue specific, KO for fate mapping) and how it was carried out?
Have you checked the KO with Southern blot application?



Thank you for your understanding and co-operation in this matter. I look forward to hearing from you soon and resolving this issue as soon as possible.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up