Overview

  • Product name

  • Description

    Rabbit polyclonal to ERGIC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ERGIC3 aa 47-341.
    Sequence:

    QYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQ LDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCY GAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKN EGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYI QHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLR TNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF


    Database link: Q9Y282

  • Positive control

    • WB: HepG2, HEK-293 and MCF7 whole cell lysates. IHC-P: Human rectum tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 43 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Possible role in transport between endoplasmic reticulum and Golgi.
  • Sequence similarities

    Belongs to the ERGIC family.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Endoplasmic reticulum membrane. Cycles between the endoplasmic reticulum and the Golgi.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310015B14Rik antibody
    • AV318804 antibody
    • C20orf47 antibody
    • CGI 54 antibody
    • D2Ucla1 antibody
    • dJ477O4.2 antibody
    • DKFZp547A2190 antibody
    • Endoplasmic reticulum Golgi intermediate compartment protein 3 antibody
    • endoplasmic reticulum localized protein ERp43 antibody
    • Endoplasmic reticulum-Golgi intermediate compartment protein 3 antibody
    • ERGI3_HUMAN antibody
    • ERGIC and golgi 3 antibody
    • ergic3 antibody
    • ERV46 antibody
    • NY BR 84 antibody
    • PRO0989 antibody
    • RP23-220D12.2 antibody
    • RP3-477O4.1 antibody
    • SDBCAG84 antibody
    • Serologically defined breast cancer antigen 84 antibody
    • Serologically defined breast cancer antigen NY BR 84 antibody
    • Serologically defined breast cancer antigen NY-BR-84 antibody
    see all

Images

  • All lanes : Anti-ERGIC3 antibody (ab236723) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 43 kDa

  • Paraffin-embedded human rectum tissue stained for ERGIC3  using ab236723 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ERGIC3 (green) using ab236723 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG(H+L).

References

ab236723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up