Anti-ERGIC3 antibody (ab236723)
Key features and details
- Rabbit polyclonal to ERGIC3
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ERGIC3 antibody
See all ERGIC3 primary antibodies -
Description
Rabbit polyclonal to ERGIC3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human ERGIC3 aa 47-341.
Sequence:QYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQ LDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCY GAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKN EGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYI QHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLR TNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF
Database link: Q9Y282 -
Positive control
- WB: HepG2, HEK-293 and MCF7 whole cell lysates. IHC-P: Human rectum tissue. ICC/IF: HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236723 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2000. Predicted molecular weight: 43 kDa. | |
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Possible role in transport between endoplasmic reticulum and Golgi. -
Sequence similarities
Belongs to the ERGIC family. -
Cellular localization
Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Endoplasmic reticulum membrane. Cycles between the endoplasmic reticulum and the Golgi. - Information by UniProt
-
Database links
- Entrez Gene: 51614 Human
- Entrez Gene: 66366 Mouse
- SwissProt: Q9Y282 Human
- SwissProt: Q9CQE7 Mouse
- Unigene: 472558 Human
- Unigene: 141276 Mouse
-
Alternative names
- 2310015B14Rik antibody
- AV318804 antibody
- C20orf47 antibody
see all
Images
-
Western blot - Anti-ERGIC3 antibody (ab236723)All lanes : Anti-ERGIC3 antibody (ab236723) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 43 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ERGIC3 antibody (ab236723)Paraffin-embedded human rectum tissue stained for ERGIC3 using ab236723 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-ERGIC3 antibody (ab236723)HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ERGIC3 (green) using ab236723 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG(H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236723 has not yet been referenced specifically in any publications.
