Overview

  • Product name

  • Description

    Rabbit polyclonal to ERK5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human ERK5 aa 560-793. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    VLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPVQPTSPPPGP VAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIAT STSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPD VNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGV ADGPQDGQADSASLSASLLADWLEGHGMNPADIE


    Database link: Q13164

  • Positive control

    • IHC-P: Human colorectal cancer, lung cancer and kidney tissues. WB: Pig colon lysate; HeLa cell lysate; Recombinant human ERK5 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 88 kDa.

Target

  • Function

    Plays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream targets including MEF2C. EGF activates MAPK7 through a Ras-independent and MAP2K5-dependent pathway. May have a role in muscle cell differentiation. May be important for endothelial function and maintenance of blood vessel integrity. MAP2K5 and MAPK7 interact specifically with one another and not with MEK1/ERK1 or MEK2/ERK2 pathways.
  • Tissue specificity

    Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The second proline-rich region may interact with actin targeting the kinase to a specific location in the cell.
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-219 and Tyr-221, which activates the enzyme (By similarity). Autophosphorylated in vitro on threonine and tyrosine residues when the C-terminal part of the kinase, which could have a regulatory role, is absent.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates to the nucleus upon activation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Big MAP kinase 1 antibody
    • BMK 1 antibody
    • BMK 1 kinase antibody
    • BMK-1 antibody
    • BMK1 antibody
    • BMK1 Kinase antibody
    • EC 2.7.11.24 antibody
    • ERK 4 antibody
    • ERK 5 antibody
    • ERK-5 antibody
    • ERK4 antibody
    • ERK5 antibody
    • Extracellular signal regulated kinase 5 antibody
    • Extracellular signal-regulated kinase 5 antibody
    • MAP kinase 7 antibody
    • MAPK 7 antibody
    • MAPK7 antibody
    • Mitogen activated protein kinase 7 antibody
    • Mitogen-activated protein kinase 7 antibody
    • MK07_HUMAN antibody
    • OTTHUMP00000065906 antibody
    • OTTHUMP00000065907 antibody
    • PRKM 7 antibody
    • PRKM7 antibody
    • PROTEIN KINASE, MITOGEN-ACTIVATED, 7 antibody
    see all

Images

  • Paraffin-embedded human colorectal cancer tissue stained for ERK5 using ab232748 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human lung cancer tissue stained for ERK5 using ab232748 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for ERK5 using ab232748 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ERK5 antibody (ab232748) at 2 µg/ml + Recombinant human ERK5 protein

    Predicted band size: 88 kDa

  • Anti-ERK5 antibody (ab232748) at 2 µg/ml + Pig colon tissue lysate

    Predicted band size: 88 kDa

  • Anti-ERK5 antibody (ab232748) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 88 kDa

References

ab232748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up