Anti-Erlin-2 antibody (ab233440)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Erlin-2 antibody
See all Erlin-2 primary antibodies -
Description
Rabbit polyclonal to Erlin-2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Pig
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human Erlin-2 aa 47-339. Expressed in E.coli. N-terminal tags.
Sequence:PGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLV PNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDE NLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIA AQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIE DAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIY FGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Database link: O94905 -
Positive control
- WB: Recombinant human Erlin-2 protein; HeLa and HepG2 cell lysates; Pig kidney lysate; Human milk. IHC-P: Human cerebrum, lung cancer, liver and liver cancer tissue.
-
General notes
Previously labelled as SPFH2.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233440 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 38 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs). Also involved in ITPR1 degradation by the ERAD pathway. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the band 7/mec-2 family. -
Cellular localization
Endoplasmic reticulum membrane. Associated with lipid raft-like domains of the endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 11160 Human
- Entrez Gene: 244373 Mouse
- Entrez Gene: 100233180 Pig
- Entrez Gene: 290823 Rat
- Omim: 611605 Human
- SwissProt: Q1RMU4 Cow
- SwissProt: O94905 Human
- SwissProt: Q8BFZ9 Mouse
see all -
Alternative names
- C8orf2 antibody
- Chromosome 8 open reading frame 2 antibody
- Endoplasmic reticulum lipid raft associated protein 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Erlin-2 antibody (ab233440)Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.
-
Western blot - Anti-Erlin-2 antibody (ab233440)Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 38 kDa -
Western blot - Anti-Erlin-2 antibody (ab233440)Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 38 kDa -
Western blot - Anti-Erlin-2 antibody (ab233440)Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + Pig kidney lysate
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 38 kDa -
Western blot - Anti-Erlin-2 antibody (ab233440)Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + Human milk
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 38 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Erlin-2 antibody (ab233440)Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Erlin-2 antibody (ab233440)Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Erlin-2 antibody (ab233440)Formalin-fixed, paraffin-embedded human liver tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Erlin-2 antibody (ab233440)Formalin-fixed, paraffin-embedded human prostate gland tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.
-
Western blot - Anti-Erlin-2 antibody (ab233440)Anti-Erlin-2 antibody (ab233440) at 2 µg/ml + Recombinant human Erlin-2 protein
Predicted band size: 38 kDa
Datasheets and documents
References
ab233440 has not yet been referenced specifically in any publications.
