Overview

  • Product name

  • Description

    Rabbit polyclonal to Erlin-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Erlin-2 aa 47-339. Expressed in E.coli. N-terminal tags.
    Sequence:

    PGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLV PNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDE NLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIA AQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIE DAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIY FGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN


    Database link: O94905

  • Positive control

    • WB: Recombinant human Erlin-2 protein; HeLa and HepG2 cell lysates; Pig kidney lysate; Human milk. IHC-P: Human cerebrum, lung cancer, liver and liver cancer tissue.
  • General notes

    Previously labelled as SPFH2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab233440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 38 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs). Also involved in ITPR1 degradation by the ERAD pathway.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the band 7/mec-2 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Associated with lipid raft-like domains of the endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C8orf2 antibody
    • Chromosome 8 open reading frame 2 antibody
    • Endoplasmic reticulum lipid raft associated protein 2 antibody
    • Endoplasmic reticulum lipid raft-associated protein 2 antibody
    • ER lipid raft associated 2 antibody
    • ERLIN 2 antibody
    • Erlin-2 antibody
    • ERLIN2 antibody
    • ERLN2_HUMAN antibody
    • HGNC:1356 antibody
    • MGC87072 antibody
    • NET32 antibody
    • SPFH 2 antibody
    • SPFH domain containing protein 2 antibody
    • SPFH domain family member 2 antibody
    • SPFH domain-containing protein 2 antibody
    • SPFH2 antibody
    • SPG18 antibody
    • Stomatin prohibitin flotillin HflC/K domain containing protein 2 antibody
    • Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 38 kDa

  • Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 38 kDa

  • Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + Pig kidney lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 38 kDa

  • Anti-Erlin-2 antibody (ab233440) at 1 µg/ml + Human milk

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 38 kDa

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate gland tissue stained for Erlin-2 using ab233440 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-Erlin-2 antibody (ab233440) at 2 µg/ml + Recombinant human Erlin-2 protein

    Predicted band size: 38 kDa

References

ab233440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up