Overview

  • Product name

  • Description

    Rabbit polyclonal to ERLIN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ERLIN1 aa 175-335. (BC031791).
    Sequence:

    IPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQV AKIRFQQKVMEKETEKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKH KLTPEYLELKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESS LPSKEALEPSG


    Database link: O75477

  • Positive control

    • Mouse kidney lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab207698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 40 kDa (predicted molecular weight: 39 kDa).

Target

  • Function

    Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs).
  • Tissue specificity

    Expressed in heart, placenta, liver, kidney, pancreas, prostate, testis, ovary and small intestine.
  • Sequence similarities

    Belongs to the band 7/mec-2 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Associated with lipid raft-like domains of the endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Band 7 23-211 Keo4 (Interim) similar to C.elegans protein antibody
    • C10orf69 antibody
    • chromosome 10 open reading frame 69 antibody
    • Endoplasmic reticulum lipid raft-associated protein 1 antibody
    • ER lipid raft associated 1 antibody
    • Erlin 1 antibody
    • Erlin-1 antibody
    • ERLIN1 antibody
    • ERLN1_HUMAN antibody
    • KE04 antibody
    • KEO4 antibody
    • OTTHUMP00000059425 antibody
    • Protein KE04 antibody
    • SPFH domain containing protein 1 antibody
    • SPFH domain family, member 1 antibody
    • SPFH domain-containing protein 1 antibody
    • SPFH1 antibody
    • SPG62 antibody
    • Stomatin-prohibitin-flotillin-HflC/K domain containing protein 1 antibody
    • Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1 antibody
    see all

Images

References

ab207698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up