Overview

  • Product name

    Anti-Eros antibody
  • Description

    Rabbit polyclonal to Eros
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Eros aa 125-187.
    Sequence:

    MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQ SSDSEAGDPASQS

  • Positive control

    • Human urinary bladder tissue.
  • General notes

     This product was previously labelled as C17orf62

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab150936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 21 kDa.

Target

Images

  • Anti-Eros antibody (ab150936) + Human liver tissue lysate

    Predicted band size: 21 kDa

  • Immunofluorescent staining of Human cell line A-431 shows positivity in plasma membrane and cell junctions. Recommended concentration of ab150936 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human urinary bladder tissue labeling Eros with ab150936 at a 1/500 dilution.

References

ab150936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab150936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up