Overview

  • Product name

    Anti-ERp57 antibody [CL2444]
    See all ERp57 primary antibodies
  • Description

    Mouse monoclonal [CL2444] to ERp57
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ERp57 aa 101-218.
    Sequence:

    PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFIS DKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNG EGIILFRPSHLTNKFEDK


    Database link: P30101

  • Epitope

    Binds to an epitope located within the peptide sequence KKFISDKDASIVGFF as determined by overlapping synthetic peptides.
  • Positive control

    • WB: U-251 MG cell lysate. IHC-P: Human thyroid gland, cerebral cortex and endometrium tissue. ICC/IF: HeLa, A431, MCF7, U-2 OS and U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    CL2444
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab242367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P 1/5000 - 1/10000.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Tissue specificity

    Detected in the flagellum and head region of spermatozoa (at protein level).
  • Sequence similarities

    Belongs to the protein disulfide isomerase family.
    Contains 2 thioredoxin domains.
  • Cellular localization

    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • 58 kDa glucose regulated protein antibody
    • 58 kDa glucose-regulated protein antibody
    • 58 kDa microsomal protein antibody
    • Disulfide isomerase ER 60 antibody
    • Disulfide isomerase ER-60 antibody
    • Endoplasmic reticulum resident protein 57 antibody
    • Endoplasmic reticulum resident protein 60 antibody
    • ER p57 antibody
    • ER protein 57 antibody
    • ER protein 60 antibody
    • ERp 57 antibody
    • ERp57 antibody
    • ERp60 antibody
    • ERp61 antibody
    • Glucose Regulated Protein 58 Kd antibody
    • GRP 57 antibody
    • GRP 58 antibody
    • GRP57 antibody
    • HsT17083 antibody
    • p58 antibody
    • PDIA 3 antibody
    • PDIA3 antibody
    • PDIA3_HUMAN antibody
    • Phospholipase C alpha antibody
    • PI PLC antibody
    • Protein disulfide isomerase A3 antibody
    • Protein disulfide isomerase family A member 3 antibody
    • Protein disulfide-isomerase A3 antibody
    see all

Images

  • Immunofluorescence/immunocytochemical analysis of U-251 MG (Human brain glioma cell line) cells labeling ERp57 (Green) using ab242367 at 4 µg/mL. The nuclear counterstain is DAPI (Blue).

  • Immunofluorescence/immunocytochemical analysis of U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling ERp57 (Green) using ab242367 at 4 µg/mL. The nuclear counterstain is DAPI (Blue).

  • Immunofluorescence/immunocytochemical analysis of MCF7 (human breast adenocarcinoma cell line) cells labeling ERp57 (Green) using ab242367 at 4 µg/mL. The nuclear counterstain is DAPI (Blue).

  • Immunofluorescence/immunocytochemical analysis of A431 (human epidermoid carcinoma cell line) cells labeling ERp57 (Green) using ab242367 at 4 µg/mL. The nuclear counterstain is DAPI (Blue).

  • Immunofluorescence/immunocytochemical analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling ERp57 (Green) using ab242367 at 4 µg/mL. The nuclear counterstain is DAPI (Blue).

  • All lanes : Anti-ERp57 antibody [CL2444] (ab242367) at 1 µg/ml

    Lane 1 : U-251 MG (Human brain glioma cell line) cells transfected with a control siRNA
    Lane 2 : U-251 MG cells transfected with a target-specific siRNA probe
    Lane 3 : U-251 MG cells transfected with a second target-specific siRNA probe

    Predicted band size: 57 kDa

  • Paraffin-embedded human endometrium tissue stained for ERp57 using ab242367 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for ERp57 using ab242367 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid gland tissue stained for ERp57 using ab242367 at 1/5000 dilution in immunohistochemical analysis.

  • Negative control:

    Paraffin-embedded human skeletal muscle tissue stained for ERp57 using ab242367 at 1/5000 dilution in immunohistochemical analysis.

References

ab242367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up