Overview

  • Product name

  • Description

    Rabbit polyclonal to ERp72
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human ERp72 aa 505-636. (Expressed in E.coli).
    Sequence:

    FKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPW CGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIY FAPSGDKKNPVKFEGGDRDLEHLSKFIEEHAT


    Database link: P13667

  • Positive control

    • IHC-P: Human colorectal cancer, prostate cancer, stomach, stomach cancer and pancreas tissues. ICC/IF: HeLa cells. WB: HeLa and A431 cell lysates; Pig liver and brain lysates; Recombinant human ERp72 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232749 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 73 kDa.

Target

  • Sequence similarities

    Belongs to the protein disulfide isomerase family.
    Contains 3 thioredoxin domains.
  • Cellular localization

    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium binding protein intestinal related antibody
    • Endoplasmic reticulum resident protein 70 antibody
    • Endoplasmic reticulum resident protein 72 antibody
    • EPR70 antibody
    • EPR72 antibody
    • ER protein 70 antibody
    • ER protein 72 antibody
    • ERP 70 antibody
    • ERp 72 antibody
    • ERp-72 antibody
    • ERp70 antibody
    • ERp72 antibody
    • PDIA 4 antibody
    • Pdia4 antibody
    • PDIA4_HUMAN antibody
    • PDIR antibody
    • Protein disulfide isomerase A4 antibody
    • Protein disulfide isomerase associated 4 antibody
    • Protein disulfide isomerase family A member 4 antibody
    • protein disulfide isomerase related protein (calcium-binding protein, intestinal-related) antibody
    • Protein disulfide isomerase related protein antibody
    • Protein disulfide-isomerase A4 antibody
    • Protein ERp 72 antibody
    • Protein ERp72 antibody
    see all

Images

  • Anti-ERp72 antibody (ab232749) at 3 µg/ml + Recombinant human ERp72 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 73 kDa

  • Paraffin-embedded human colorectal cancer tissue stained for ERp72 using ab232749 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for ERp72 using ab232749 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for ERp72 using ab232749 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for ERp72 using ab232749 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human pancreas tissue stained for ERp72 using ab232749 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ERp72 (green) using ab232749 at 20 µg/ml in ICC/IF, followed by FITC staining.

  • All lanes : Anti-ERp72 antibody (ab232749) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Pig liver lysate
    Lane 3 : Pig brain lysate
    Lane 4 : A431 (human epidermoid carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 73 kDa

References

ab232749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up