Overview

  • Product name

  • Description

    Rabbit polyclonal to ERVW-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human ERVW-1 aa 21-443. Extracellular domain.
    Sequence:

    APPPCRCMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPR NCYHSATLCMHANTHYWTGKMINPSCPGGLGVTVCWTYFTQTGMSDGGGV QDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNT TLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINTTSVLV GPLVSNLEITHTSNLTCVKFSNTTYTTNSQCIRWVTPPTQIVCLPSGIFF VCGTSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPI LPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQD QLNSLAAVVLQNRRALDLLTAERGGTCLFLGEECCYYVNQSGIVTEKVKE IRDRIQRRAEELRNTGPWGLLSQ


    Database link: Q9UQF0

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has retained its original fusogenic properties and participates in trophoblast fusion during placenta morphogenesis. SU mediates receptor recognition. This interaction triggers the refolding of the transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide By similarity. Seems to recognize the type D mammalian retrovirus receptors SLC1A4 and SLC1A5, as it induces fusion of cells expressing these receptors in vitro. The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of membranes
  • Cellular localization

    Transmembrane protein: Cell membrane; Single-pass type I membrane protein Surface protein: Cell membrane; Peripheral membrane protein
  • Database links

  • Alternative names

    • Endogenous retrovirus group W member 1 antibody
    • ENV antibody
    • Envelope polyprotein gPr73 antibody
    • Enverin antibody
    • ENVW antibody
    • ERVWE1 antibody
    • HERV-7q antibody
    • HERV-7q Envelope protein antibody
    • HERV-W envelope protein antibody
    • HERV-W-ENV antibody
    • HERV-W_7q21.2 provirus ancestral Env polyprotein antibody
    • HERV7Q antibody
    • HERVW antibody
    • HERVWENV antibody
    • Syncytin 1 antibody
    • Syncytin antibody
    • Syncytin1 antibody
    see all

Images

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for ERVW-1(green) using ab234850 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human placenta tissue stained for ERVW-1 with ab234850 (1/100 dilution) in immunohistochemical analysis.

References

ab234850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Tissue lysate - whole (Placenta, Omentum, Fallopian tube, Ovary, Endometr)
Gel Running Conditions
Reduced Denaturing (7-20%)
Loading amount
20 µg
Specification
Placenta, Omentum, Fallopian tube, Ovary, Endometr
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Oct 30 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up