Overview

  • Product name

  • Description

    Rabbit polyclonal to ESCO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ESCO2 aa 313-395.
    Sequence:

    LGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFMKQTNIQKNT NTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMI


    Database link: Q56NI9

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    ESCO2 is an acetyltransferase required for the establishment of sister chromatid cohesion, and couples the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to the structural cohesins, the deposition and establishment factors are required only during S phase. Defects in ESCO2 are the cause of Roberts syndrome (RBS), a rare autosomal recessive disorder characterized by pre- and postnatal growth retardation, microcephaly, bilateral cleft lip and palate, and mesomelic symmetric limb reduction. Severely affected infants may be stillborn or die shortly after birth. RBS chromosomes have a lack of cohesion involving the heterochromatic C-banding regions around centromeres and the distal portion of the long arm of the Y chromosome (known as premature centromere separation, heterochromatin repulsion or puffing, or RS effect). Defects in ESCO2 are also the cause of SC phocomelia syndrome, also known as SC pseudothalidomide syndrome. SC phocomelia syndrome has a milder phenotype than RBS, with a lesser degree of symmetric limb reduction and additionally includes flexion contractures of various joints, midfacial hemangioma, hypoplastic cartilage of ears and nose, scant silvery-blond hair, and cloudy corneae. Although microcephaly is present, mental retardation may be mild and survival into adulthood is common.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • CTF7, S. CEREVISIAE, HOMOLOG OF, 2 antibody
    • ECO1 homolog 2 antibody
    • ECO1, S. CEREVISIAE, HOMOLOG OF, 2 antibody
    • EFO2 antibody
    • ESO1, S. POMBE, HOMOLOG OF, 2 antibody
    • ESTABLISHMENT FACTOR ORTHOLOG 2; EFO2 antibody
    • Establishment of cohesion 1 homolog 2 antibody
    • Establishment of cohesion 1 homolog 2 (S. cerevisiae) antibody
    • N acetyltransferase ESCO2 antibody
    • RBS antibody
    • Roberts syndrome antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, triton X-100 permeabilized U-2 OS cells labeling ESCO2 with ab219996 at 4 μg/ml (green).

References

ab219996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% Triton X100 in PBS
Specification
HeLa
Fixative
Paraformaldehyde

Dr. Kirk Mcmanus

Verified customer

Submitted Aug 25 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up