Anti-ESM1 antibody (ab224591)
Key features and details
- Rabbit polyclonal to ESM1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ESM1 antibody
See all ESM1 primary antibodies -
Description
Rabbit polyclonal to ESM1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ESM1 aa 20-184.
Sequence:WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTV SGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQS GICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKE NAAGSPVMRKWLNPR
Database link: Q9NQ30 -
Positive control
- IHC: Human lung tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol, PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224591 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
May have potent implications in lung endothelial cell-leukocyte interactions. -
Tissue specificity
Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney. -
Sequence similarities
Contains 1 IGFBP N-terminal domain. -
Post-translational
modificationsMay contain intrachain disulfide bonds. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 11082 Human
- Omim: 601521 Human
- SwissProt: Q9NQ30 Human
- Unigene: 129944 Human
-
Alternative names
- Endocan antibody
- Endothelial cell specific molecule 1 antibody
- Endothelial cell-specific molecule 1 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (2)
ab224591 has been referenced in 2 publications.
- Lee YH et al. Endocan as a marker of microvascular inflammation in kidney transplant recipients. Sci Rep 9:1854 (2019). PubMed: 30755622
- Xie X et al. ALDH1A3 Regulations of Matricellular Proteins Promote Vascular Smooth Muscle Cell Proliferation. iScience 19:872-882 (2019). PubMed: 31513972