Anti-ESM1 antibody (ab224591)

Submit a review Submit a question References (2)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ESM1 antibody (ab224591)

    Key features and details

    • Rabbit polyclonal to ESM1
    • Suitable for: IHC-P
    • Reacts with: Human
    • Isotype: IgG

    Overview

    • Product name

      Anti-ESM1 antibody
      See all ESM1 primary antibodies

    • Description

      Rabbit polyclonal to ESM1

    • Host species

      Rabbit

    • Tested applications

      Suitable for: IHC-Pmore details

    • Species reactivity

      Reacts with: Human

    • Immunogen

      Recombinant fragment corresponding to Human ESM1 aa 20-184.
      Sequence:

      WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTV SGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQS GICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKE NAAGSPVMRKWLNPR


      Database link: Q9NQ30
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • IHC: Human lung tissue.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid

    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    • Storage buffer

      pH: 7.40
      Constituents: 50% Glycerol, PBS, 0.03% Proclin 300
    • Concentration information loading...

    • Purity

      Protein G purified

    • Clonality

      Polyclonal

    • Isotype

      IgG

    • Research areas

    Applications

    Our Abpromise guarantee covers the use of ab224591 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P 1/20 - 1/200.

    Target

    • Function

      May have potent implications in lung endothelial cell-leukocyte interactions.

    • Tissue specificity

      Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.

    • Sequence similarities

      Contains 1 IGFBP N-terminal domain.

    • Post-translational
      modifications

      May contain intrachain disulfide bonds.

    • Cellular localization

      Secreted.
    • Information by UniProt

    • Database links

      • Alternative names

        • Endocan antibody
        • Endothelial cell specific molecule 1 antibody
        • Endothelial cell-specific molecule 1 antibody
        • ESM 1 antibody
        • ESM 1 secretory protein antibody
        • ESM-1 antibody
        • Esm1 antibody
        • ESM1 secretory protein antibody
        • ESM1_HUMAN antibody
        see all

      Images

      • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ESM1 antibody (ab224591)
        Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ESM1 antibody (ab224591)

        Paraffin-embedded human lung tissue tissue stained for ESM1 using ab224591 at 1/100 dilution in immunohistochemical analysis.

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      References (2)

      Publishing research using ab224591? Please let us know so that we can cite the reference in this datasheet.

      ab224591 has been referenced in 2 publications.

      • Lee YH  et al. Endocan as a marker of microvascular inflammation in kidney transplant recipients. Sci Rep 9:1854 (2019). PubMed: 30755622
      • Xie X  et al. ALDH1A3 Regulations of Matricellular Proteins Promote Vascular Smooth Muscle Cell Proliferation. iScience 19:872-882 (2019). PubMed: 31513972

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab224591.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com