Overview

  • Product name

    Anti-Estrogen Inducible Protein pS2 antibody
    See all Estrogen Inducible Protein pS2 primary antibodies
  • Description

    Rabbit polyclonal to Estrogen Inducible Protein pS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Rat Estrogen Inducible Protein pS2 aa 1-81. (Expressed in E.coli)
    Sequence:

    MEHKVTCVLAMVLMLALSSLAQNQEETCAVIPRERINCGFPGVTAQQCKE KGCCFDDSVRGFPWCFRPLVIENQQEEECPF


    Database link: Q63467

  • Positive control

    • IHC-P: Rat stomach tissue. WB: Recombinant rat Estrogen Inducible Protein pS2 protein; Rat stomach lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 9 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
  • Tissue specificity

    Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal glands of the trachea, and epithelial cells lining the exocrine pancreatic ducts but not in the remainder of the pancreas (at protein level). Scattered expression is detected in the epithelial cells of the gallbladder and submucosal glands of the vagina, and weak expression is observed in the bronchial goblet cells of the pseudostratified epithelia in the respiratory system (at protein level). Detected in urine (at protein level). Strongly expressed in breast cancer but at low levels in normal mammary tissue. It is regulated by estrogen in MCF-7 cells. Strong expression found in normal gastric mucosa and in the regenerative tissues surrounding ulcerous lesions of gastrointestinal tract, but lower expression found in gastric cancer (at protein level).
  • Sequence similarities

    Contains 1 P-type (trefoil) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCEI antibody
    • Breast cancer estrogen inducible protein antibody
    • Breast cancer estrogen inducible sequence antibody
    • Breast cancer estrogen-inducible protein antibody
    • D21S21 antibody
    • Gastrointestinal trefoil protein antibody
    • Gastrointestinal trefoil protein pS2 antibody
    • hP1.A antibody
    • HP1A antibody
    • HPS 2 antibody
    • HPS2 antibody
    • pNR 2 antibody
    • PNR-2 antibody
    • pNR2 antibody
    • Polypeptide P1.A antibody
    • Protein pS2 antibody
    • PS 2 antibody
    • pS2 antibody
    • pS2 protein antibody
    • TFF 1 antibody
    • TFF1 antibody
    • TFF1_HUMAN antibody
    • Trefoil factor 1 antibody
    see all

Images

  • Anti-Estrogen Inducible Protein pS2 antibody (ab231713) at 2 µg/ml + Rat stomach tissue.

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 9 kDa

  • Anti-Estrogen Inducible Protein pS2 antibody (ab231713) at 2 µg/ml + Recombinant rat Estrogen Inducible Protein pS2 protein.

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 9 kDa

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Estrogen Inducible Protein pS2 using ab231713 at 20ug/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Estrogen Inducible Protein pS2 using ab231713 at 20ug/ml in immunohistochemical analysis.

References

ab231713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up