For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    estrogen-related-receptor-alpha-antibody-ab137489.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger
Share by email

Anti-Estrogen Related Receptor alpha antibody (ab137489)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
  • Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
  • ChIP - Anti-Estrogen Related Receptor alpha antibody (ab137489)
  • Immunoprecipitation - Anti-Estrogen Related Receptor alpha antibody (ab137489)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Estrogen Related Receptor alpha antibody (ab137489)
  • Western blot - Anti-Estrogen Related Receptor alpha antibody - N-terminal (ab137489)

Key features and details

  • Rabbit polyclonal to Estrogen Related Receptor alpha
  • Suitable for: ChIP, IHC-P, IP, WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human Estrogen Related Receptor alpha protein (ab152370)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Primary
Product image
Anti-Neurofilament heavy polypeptide antibody [EPR20020] (ab207176)

View more associated products

Overview

  • Product name

    Anti-Estrogen Related Receptor alpha antibody
    See all Estrogen Related Receptor alpha primary antibodies
  • Description

    Rabbit polyclonal to Estrogen Related Receptor alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ChIP, IHC-P, IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Estrogen Related Receptor alpha aa 1-45 (N terminal).
    Sequence:

    MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTR


    Database link: P11474
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Zinc Finger
    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • Nuclear Hormone Receptors
    • Estrogen
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • Nuclear Receptors
    • Estrogen
    • Cancer
    • Signal transduction
    • Nuclear signaling
    • Nuclear hormone receptors
    • Estrogen
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial Biogenesis
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Nucleotide metabolism
    • Molecular processes
    • Mitochondrial transcription
    • Neuroscience
    • Development
    • Neuroscience
    • Processes

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Raji whole cell lysate (ab30124)
    • A-431 whole cell lysate (ab7909)
  • Recombinant Protein

    • Recombinant Human Estrogen Related Receptor alpha protein (ab152370)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab137489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP
Use at an assay dependent concentration.
IHC-P
1/100 - 1/1000.
IP
1/100 - 1/500.
WB
1/500 - 1/3000. Predicted molecular weight: 46 kDa.
Notes
ChIP
Use at an assay dependent concentration.
IHC-P
1/100 - 1/1000.
IP
1/100 - 1/500.
WB
1/500 - 1/3000. Predicted molecular weight: 46 kDa.

Target

  • Function

    Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylation on Ser-19 enhances sumoylation on Lys-14 increasing repression of transcriptional activity.
    Sumoylated by SUMO2. Main site is Lys-14 which is enhanced by phosphorylation on Ser-19, cofactor activation, and by interaction with PIAS4. Sumoylation enhances repression of transcriptional activiy, but has no effect on subcellular location nor on DNA binding.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P11474 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 507834 Cow
    • Entrez Gene: 403169 Dog
    • Entrez Gene: 2101 Human
    • Entrez Gene: 26379 Mouse
    • Entrez Gene: 100322868 Pig
    • Entrez Gene: 293701 Rat
    • Omim: 601998 Human
    • SwissProt: Q6QMY5 Dog
    • SwissProt: P11474 Human
    • SwissProt: O08580 Mouse
    • SwissProt: Q5QJV7 Rat
    • Unigene: 110849 Human
    • Unigene: 386776 Mouse
    • Unigene: 130171 Rat
    see all
  • Alternative names

    • Err 1 antibody
    • ERR a antibody
    • ERR alpha antibody
    • ERR-alpha antibody
    • Err1 antibody
    • ERR1 protein antibody
    • ERR1_HUMAN antibody
    • ERRa antibody
    • ERRalpha antibody
    • ESRL 1 antibody
    • ESRL1 antibody
    • ESRR A antibody
    • Esrra antibody
    • Estrogen receptor like 1 antibody
    • Estrogen receptor related 1 antibody
    • estrogen receptor related receptor alpha antibody
    • Estrogen receptor-like 1 antibody
    • Estrogen related receptor alpha antibody
    • Estrogen-related receptor alpha antibody
    • Estrra antibody
    • hERR1 antibody
    • NR3B1 antibody
    • Nuclear receptor subfamily 3 group B member 1 antibody
    • Steroid hormone receptor ERR1 antibody
    see all

Images

  • Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Neuro2A whole cell extract at 30 µg

    Predicted band size: 46 kDa



    10% SDS-PAGE

  • Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Rat2 whole cell extract at 30 µg

    Predicted band size: 46 kDa



    10% SDS-PAGE

  • ChIP - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    ChIP - Anti-Estrogen Related Receptor alpha antibody (ab137489)

    Cross-linked ChIP was performed with MCF-7 chromatin extract and 5 μg of either control rabbit IgG or anti-ERR alpha antibody. The precipitated DNA was detected by PCR with primer set targeting to PS2 promoter or GAPDH promoter.

  • Immunoprecipitation - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Immunoprecipitation - Anti-Estrogen Related Receptor alpha antibody (ab137489)

    ERR alpha was immunoprecipitated from 40µ of HEK-293T whole cell lysate with ab137489 at 1/1000 dilution. Secondary antibody EasyBlot anti-rabbit IgG was used as secondary antibody.
    Lane 1: 40 μg HEK-293T whole cell lysate.
    Lane 2: Control with 2 μg of preimmune rabbit IgG. 
    Lane 3: Immunoprecipitation of ERR alpha protein by 2 μg of ERR alpha antibody.

    7.5% SDS-PAGE

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Estrogen Related Receptor alpha antibody (ab137489)

    Paraffin embedded mouse heart tissue stained for ERR alpha using ab137489 at 1/500 dilution in immunohistochemical analysis.

  • Western blot - Anti-Estrogen Related Receptor alpha antibody - N-terminal (ab137489)
    Western blot - Anti-Estrogen Related Receptor alpha antibody - N-terminal (ab137489)
    All lanes : Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution

    Lane 1 : 293T whole cell lysate
    Lane 2 : A431 whole cell lysate
    Lane 3 : H1299 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 46 kDa



    12% SDS PAGE

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab137489? Please let us know so that we can cite the reference in this datasheet.

ab137489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab137489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.