Anti-Estrogen Related Receptor alpha antibody (ab137489)
Key features and details
- Rabbit polyclonal to Estrogen Related Receptor alpha
- Suitable for: ChIP, IHC-P, IP, WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Estrogen Related Receptor alpha antibody
See all Estrogen Related Receptor alpha primary antibodies -
Description
Rabbit polyclonal to Estrogen Related Receptor alpha -
Host species
Rabbit -
Tested applications
Suitable for: ChIP, IHC-P, IP, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Dog, Pig -
Immunogen
Synthetic peptide corresponding to Human Estrogen Related Receptor alpha aa 1-45 (N terminal).
Sequence:MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTR
Database link: P11474 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab137489 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ChIP |
Use at an assay dependent concentration.
|
|
IHC-P |
1/100 - 1/1000.
|
|
IP |
1/100 - 1/500.
|
|
WB |
1/500 - 1/3000. Predicted molecular weight: 46 kDa.
|
Notes |
---|
ChIP
Use at an assay dependent concentration. |
IHC-P
1/100 - 1/1000. |
IP
1/100 - 1/500. |
WB
1/500 - 1/3000. Predicted molecular weight: 46 kDa. |
Target
-
Function
Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism. -
Sequence similarities
Belongs to the nuclear hormone receptor family. NR3 subfamily.
Contains 1 nuclear receptor DNA-binding domain. -
Post-translational
modificationsPhosphorylation on Ser-19 enhances sumoylation on Lys-14 increasing repression of transcriptional activity.
Sumoylated by SUMO2. Main site is Lys-14 which is enhanced by phosphorylation on Ser-19, cofactor activation, and by interaction with PIAS4. Sumoylation enhances repression of transcriptional activiy, but has no effect on subcellular location nor on DNA binding. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 507834 Cow
- Entrez Gene: 403169 Dog
- Entrez Gene: 2101 Human
- Entrez Gene: 26379 Mouse
- Entrez Gene: 100322868 Pig
- Entrez Gene: 293701 Rat
- Omim: 601998 Human
- SwissProt: Q6QMY5 Dog
see all -
Alternative names
- Err 1 antibody
- ERR a antibody
- ERR alpha antibody
see all
Images
-
Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Neuro2A whole cell extract at 30 µg
Predicted band size: 46 kDa10% SDS-PAGE
-
Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Rat2 whole cell extract at 30 µg
Predicted band size: 46 kDa10% SDS-PAGE
-
Cross-linked ChIP was performed with MCF-7 chromatin extract and 5 μg of either control rabbit IgG or anti-ERR alpha antibody. The precipitated DNA was detected by PCR with primer set targeting to PS2 promoter or GAPDH promoter.
-
ERR alpha was immunoprecipitated from 40µ of HEK-293T whole cell lysate with ab137489 at 1/1000 dilution. Secondary antibody EasyBlot anti-rabbit IgG was used as secondary antibody.
Lane 1: 40 μg HEK-293T whole cell lysate.
Lane 2: Control with 2 μg of preimmune rabbit IgG.
Lane 3: Immunoprecipitation of ERR alpha protein by 2 μg of ERR alpha antibody.7.5% SDS-PAGE
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Estrogen Related Receptor alpha antibody (ab137489)
Paraffin embedded mouse heart tissue stained for ERR alpha using ab137489 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution
Lane 1 : 293T whole cell lysate
Lane 2 : A431 whole cell lysate
Lane 3 : H1299 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 46 kDa
12% SDS PAGE
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab137489 has not yet been referenced specifically in any publications.